Aotus nancymaae (Ma's night monkey): 105722834 Help Entry 105722834         CDS       T10127                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04015   Rap1 signaling pathway anan04810   Regulation of actin cytoskeleton anan05014   Amyotrophic lateral sclerosis anan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105722834 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105722834 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105722834 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105722834 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:anan04131]     105722834 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:anan04812]     105722834 (PFN1)    04147 Exosome [BR:anan04147]     105722834 (PFN1) Membrane trafficking [BR:anan04131]  Others   Actin-binding proteins    Others     105722834 (PFN1) Cytoskeleton proteins [BR:anan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105722834 (PFN1) Exosome [BR:anan04147]  Exosomal proteins   Proteins found in most exosomes    105722834 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105722834 NCBI-ProteinID:  XP_012315990 Ensembl:  ENSANAG00000002125 UniProt:  A0A2K5BV26 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRAQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaatgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccctgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagtttttac gtgaatgggctgacgcttgggggccagaaatgttcggttatccgggactcactgctgcag gatggggaatttagcatggatcttcgtaccaagagcaccggtggagcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcgacgtgcccagtac tga

DBGET integrated database retrieval system