Aotus nancymaae (Ma's night monkey): 105723299 Help Entry 105723299         CDS       T10127                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04382   Cornified envelope formation anan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105723299  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105723299  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105723299 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of microglial cells    105723299 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 Motif Other DBs NCBI-GeneID:  105723299 NCBI-ProteinID:  XP_012316664 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MPPQMEHATETTMFTFHKFAGDKSYLTKEDLRVLTEKEFPGFLENQKDPLAVYKIKKDLD QCRDGKVGFQSCFSLIAGLTIACKTLL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccacctcaaatggaacatgccacggaaaccacgatgtttacatttcacaaatttgct ggggataaaagctacttaacaaaggaggacctgagagtactcacggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggccgtgtacaaaataaagaaggacctggac cagtgcagagatggcaaagtgggcttccagagctgcttctccctaattgcgggcctcacc attgcgtgcaagactcttttgtag

DBGET integrated database retrieval system