Aotus nancymaae (Ma's night monkey): 105724409 Help Entry 105724409         CDS       T10127                                  Symbol CFL1 Name (RefSeq) cofilin-1 isoform X2   KO K05765   cofilin Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04360   Axon guidance anan04666   Fc gamma R-mediated phagosome formation anan04810   Regulation of actin cytoskeleton anan05133   Pertussis anan05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:anan00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105724409 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     105724409 (CFL1)   09158 Development and regeneration    04360 Axon guidance     105724409 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105724409 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     105724409 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:anan04131]     105724409 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:anan04812]     105724409 (CFL1)    04147 Exosome [BR:anan04147]     105724409 (CFL1) Membrane trafficking [BR:anan04131]  Others   Actin-binding proteins    Others     105724409 (CFL1) Cytoskeleton proteins [BR:anan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      105724409 (CFL1) Exosome [BR:anan04147]  Exosomal proteins   Proteins found in most exosomes    105724409 (CFL1) SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  105724409 NCBI-ProteinID:  XP_012318375 Ensembl:  ENSANAG00000029591 UniProt:  A0A2K5DRT6 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggagtcatcaaggtgttcaatgacatgaaggtg cgcaagtcttcaacgccagaggaggtgaagaagcgcaagaaggctgtgctcttctgcctg agtgaggacaagaaaaacatcatcctggaggaaggcaaggagatcctggtgggcgatgtg ggccaaactgtcgatgacccctacgccacctttgtcaagatgctgccagataaggactgc cgctacgccctttatgatgcaacctacgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggctcctgagtctgcgccccttaagagcaaaatgatctatgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattgcaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system