KEGG   Aotus nancymaae (Ma's night monkey): 105725499
Entry
105725499         CDS       T10127                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
anan  Aotus nancymaae (Ma's night monkey)
Pathway
anan01521  EGFR tyrosine kinase inhibitor resistance
anan01522  Endocrine resistance
anan01524  Platinum drug resistance
anan04010  MAPK signaling pathway
anan04012  ErbB signaling pathway
anan04014  Ras signaling pathway
anan04015  Rap1 signaling pathway
anan04022  cGMP-PKG signaling pathway
anan04024  cAMP signaling pathway
anan04062  Chemokine signaling pathway
anan04066  HIF-1 signaling pathway
anan04068  FoxO signaling pathway
anan04071  Sphingolipid signaling pathway
anan04072  Phospholipase D signaling pathway
anan04114  Oocyte meiosis
anan04140  Autophagy - animal
anan04148  Efferocytosis
anan04150  mTOR signaling pathway
anan04151  PI3K-Akt signaling pathway
anan04210  Apoptosis
anan04218  Cellular senescence
anan04261  Adrenergic signaling in cardiomyocytes
anan04270  Vascular smooth muscle contraction
anan04350  TGF-beta signaling pathway
anan04360  Axon guidance
anan04370  VEGF signaling pathway
anan04371  Apelin signaling pathway
anan04380  Osteoclast differentiation
anan04510  Focal adhesion
anan04517  IgSF CAM signaling
anan04520  Adherens junction
anan04540  Gap junction
anan04550  Signaling pathways regulating pluripotency of stem cells
anan04611  Platelet activation
anan04613  Neutrophil extracellular trap formation
anan04620  Toll-like receptor signaling pathway
anan04621  NOD-like receptor signaling pathway
anan04625  C-type lectin receptor signaling pathway
anan04650  Natural killer cell mediated cytotoxicity
anan04657  IL-17 signaling pathway
anan04658  Th1 and Th2 cell differentiation
anan04659  Th17 cell differentiation
anan04660  T cell receptor signaling pathway
anan04662  B cell receptor signaling pathway
anan04664  Fc epsilon RI signaling pathway
anan04666  Fc gamma R-mediated phagocytosis
anan04668  TNF signaling pathway
anan04713  Circadian entrainment
anan04720  Long-term potentiation
anan04722  Neurotrophin signaling pathway
anan04723  Retrograde endocannabinoid signaling
anan04724  Glutamatergic synapse
anan04725  Cholinergic synapse
anan04726  Serotonergic synapse
anan04730  Long-term depression
anan04810  Regulation of actin cytoskeleton
anan04910  Insulin signaling pathway
anan04912  GnRH signaling pathway
anan04914  Progesterone-mediated oocyte maturation
anan04915  Estrogen signaling pathway
anan04916  Melanogenesis
anan04917  Prolactin signaling pathway
anan04919  Thyroid hormone signaling pathway
anan04921  Oxytocin signaling pathway
anan04926  Relaxin signaling pathway
anan04928  Parathyroid hormone synthesis, secretion and action
anan04929  GnRH secretion
anan04930  Type II diabetes mellitus
anan04933  AGE-RAGE signaling pathway in diabetic complications
anan04934  Cushing syndrome
anan04935  Growth hormone synthesis, secretion and action
anan04960  Aldosterone-regulated sodium reabsorption
anan05010  Alzheimer disease
anan05020  Prion disease
anan05022  Pathways of neurodegeneration - multiple diseases
anan05034  Alcoholism
anan05132  Salmonella infection
anan05133  Pertussis
anan05135  Yersinia infection
anan05140  Leishmaniasis
anan05142  Chagas disease
anan05145  Toxoplasmosis
anan05152  Tuberculosis
anan05160  Hepatitis C
anan05161  Hepatitis B
anan05163  Human cytomegalovirus infection
anan05164  Influenza A
anan05165  Human papillomavirus infection
anan05166  Human T-cell leukemia virus 1 infection
anan05167  Kaposi sarcoma-associated herpesvirus infection
anan05170  Human immunodeficiency virus 1 infection
anan05171  Coronavirus disease - COVID-19
anan05200  Pathways in cancer
anan05203  Viral carcinogenesis
anan05205  Proteoglycans in cancer
anan05206  MicroRNAs in cancer
anan05207  Chemical carcinogenesis - receptor activation
anan05208  Chemical carcinogenesis - reactive oxygen species
anan05210  Colorectal cancer
anan05211  Renal cell carcinoma
anan05212  Pancreatic cancer
anan05213  Endometrial cancer
anan05214  Glioma
anan05215  Prostate cancer
anan05216  Thyroid cancer
anan05218  Melanoma
anan05219  Bladder cancer
anan05220  Chronic myeloid leukemia
anan05221  Acute myeloid leukemia
anan05223  Non-small cell lung cancer
anan05224  Breast cancer
anan05225  Hepatocellular carcinoma
anan05226  Gastric cancer
anan05230  Central carbon metabolism in cancer
anan05231  Choline metabolism in cancer
anan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
anan05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:anan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105725499 (MAPK3)
   04012 ErbB signaling pathway
    105725499 (MAPK3)
   04014 Ras signaling pathway
    105725499 (MAPK3)
   04015 Rap1 signaling pathway
    105725499 (MAPK3)
   04350 TGF-beta signaling pathway
    105725499 (MAPK3)
   04370 VEGF signaling pathway
    105725499 (MAPK3)
   04371 Apelin signaling pathway
    105725499 (MAPK3)
   04668 TNF signaling pathway
    105725499 (MAPK3)
   04066 HIF-1 signaling pathway
    105725499 (MAPK3)
   04068 FoxO signaling pathway
    105725499 (MAPK3)
   04072 Phospholipase D signaling pathway
    105725499 (MAPK3)
   04071 Sphingolipid signaling pathway
    105725499 (MAPK3)
   04024 cAMP signaling pathway
    105725499 (MAPK3)
   04022 cGMP-PKG signaling pathway
    105725499 (MAPK3)
   04151 PI3K-Akt signaling pathway
    105725499 (MAPK3)
   04150 mTOR signaling pathway
    105725499 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    105725499 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105725499 (MAPK3)
   04148 Efferocytosis
    105725499 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105725499 (MAPK3)
   04210 Apoptosis
    105725499 (MAPK3)
   04218 Cellular senescence
    105725499 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105725499 (MAPK3)
   04520 Adherens junction
    105725499 (MAPK3)
   04540 Gap junction
    105725499 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    105725499 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105725499 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105725499 (MAPK3)
   04613 Neutrophil extracellular trap formation
    105725499 (MAPK3)
   04620 Toll-like receptor signaling pathway
    105725499 (MAPK3)
   04621 NOD-like receptor signaling pathway
    105725499 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    105725499 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    105725499 (MAPK3)
   04660 T cell receptor signaling pathway
    105725499 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    105725499 (MAPK3)
   04659 Th17 cell differentiation
    105725499 (MAPK3)
   04657 IL-17 signaling pathway
    105725499 (MAPK3)
   04662 B cell receptor signaling pathway
    105725499 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    105725499 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    105725499 (MAPK3)
   04062 Chemokine signaling pathway
    105725499 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105725499 (MAPK3)
   04929 GnRH secretion
    105725499 (MAPK3)
   04912 GnRH signaling pathway
    105725499 (MAPK3)
   04915 Estrogen signaling pathway
    105725499 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    105725499 (MAPK3)
   04917 Prolactin signaling pathway
    105725499 (MAPK3)
   04921 Oxytocin signaling pathway
    105725499 (MAPK3)
   04926 Relaxin signaling pathway
    105725499 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    105725499 (MAPK3)
   04919 Thyroid hormone signaling pathway
    105725499 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    105725499 (MAPK3)
   04916 Melanogenesis
    105725499 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105725499 (MAPK3)
   04270 Vascular smooth muscle contraction
    105725499 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105725499 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    105725499 (MAPK3)
   04725 Cholinergic synapse
    105725499 (MAPK3)
   04726 Serotonergic synapse
    105725499 (MAPK3)
   04720 Long-term potentiation
    105725499 (MAPK3)
   04730 Long-term depression
    105725499 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    105725499 (MAPK3)
   04722 Neurotrophin signaling pathway
    105725499 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    105725499 (MAPK3)
   04380 Osteoclast differentiation
    105725499 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105725499 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105725499 (MAPK3)
   05206 MicroRNAs in cancer
    105725499 (MAPK3)
   05205 Proteoglycans in cancer
    105725499 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    105725499 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    105725499 (MAPK3)
   05203 Viral carcinogenesis
    105725499 (MAPK3)
   05230 Central carbon metabolism in cancer
    105725499 (MAPK3)
   05231 Choline metabolism in cancer
    105725499 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105725499 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105725499 (MAPK3)
   05212 Pancreatic cancer
    105725499 (MAPK3)
   05225 Hepatocellular carcinoma
    105725499 (MAPK3)
   05226 Gastric cancer
    105725499 (MAPK3)
   05214 Glioma
    105725499 (MAPK3)
   05216 Thyroid cancer
    105725499 (MAPK3)
   05221 Acute myeloid leukemia
    105725499 (MAPK3)
   05220 Chronic myeloid leukemia
    105725499 (MAPK3)
   05218 Melanoma
    105725499 (MAPK3)
   05211 Renal cell carcinoma
    105725499 (MAPK3)
   05219 Bladder cancer
    105725499 (MAPK3)
   05215 Prostate cancer
    105725499 (MAPK3)
   05213 Endometrial cancer
    105725499 (MAPK3)
   05224 Breast cancer
    105725499 (MAPK3)
   05223 Non-small cell lung cancer
    105725499 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105725499 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    105725499 (MAPK3)
   05161 Hepatitis B
    105725499 (MAPK3)
   05160 Hepatitis C
    105725499 (MAPK3)
   05171 Coronavirus disease - COVID-19
    105725499 (MAPK3)
   05164 Influenza A
    105725499 (MAPK3)
   05163 Human cytomegalovirus infection
    105725499 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105725499 (MAPK3)
   05165 Human papillomavirus infection
    105725499 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105725499 (MAPK3)
   05135 Yersinia infection
    105725499 (MAPK3)
   05133 Pertussis
    105725499 (MAPK3)
   05152 Tuberculosis
    105725499 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105725499 (MAPK3)
   05140 Leishmaniasis
    105725499 (MAPK3)
   05142 Chagas disease
    105725499 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105725499 (MAPK3)
   05020 Prion disease
    105725499 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    105725499 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    105725499 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105725499 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105725499 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105725499 (MAPK3)
   04934 Cushing syndrome
    105725499 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105725499 (MAPK3)
   01524 Platinum drug resistance
    105725499 (MAPK3)
   01522 Endocrine resistance
    105725499 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:anan01001]
    105725499 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:anan03036]
    105725499 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anan04147]
    105725499 (MAPK3)
Enzymes [BR:anan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105725499 (MAPK3)
Protein kinases [BR:anan01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105725499 (MAPK3)
Chromosome and associated proteins [BR:anan03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105725499 (MAPK3)
Exosome [BR:anan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105725499 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 105725499
NCBI-ProteinID: XP_021528022
Ensembl: ENSANAG00000037745
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWPKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaagtggaaatggtgaaggggcagccgttcgacgtgggcccg
cgctatacgcagctgcagtacatcggcgagggcgcttacggcatggtcagctcggcctat
gaccatgtgcgcaagactcgagtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgctttcgccatgagaatgtc
atcggcatccgagacattcttcgggcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctaatggagactgacctgtacaagttgcttaaaagccagcagctgagcaat
gaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatccactctgcc
aatgtcctccaccgggatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatctgcgatttcggcctggcccggattgctgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacacgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaagaggatctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcctggcccaagcttttccccaagtcggac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaacaaacggatcaca
gtggaggaagcgctggcccacccctacctggagcagtactatgacccaacggatgagcca
gtggccgaggagcccttcaccttcgacatggagctggacgacctacccaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcctggggcgctggaggccccgtaa

DBGET integrated database retrieval system