Aotus nancymaae (Ma's night monkey): 105726798 Help Entry 105726798         CDS       T10127                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04015   Rap1 signaling pathway anan04810   Regulation of actin cytoskeleton anan05014   Amyotrophic lateral sclerosis anan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105726798 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105726798 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105726798 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105726798 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:anan04131]     105726798 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:anan04812]     105726798 (PFN3)    04147 Exosome [BR:anan04147]     105726798 (PFN3) Membrane trafficking [BR:anan04131]  Others   Actin-binding proteins    Others     105726798 (PFN3) Cytoskeleton proteins [BR:anan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105726798 (PFN3) Exosome [BR:anan04147]  Exosomal proteins   Proteins found in most exosomes    105726798 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105726798 NCBI-ProteinID:  XP_012321757 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHADNRCVWASRPGGLLAAVSPQEVGVLTGPDRRTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTNGLDARAVCVGHAPRALLVLMGRRGVHGGI LNKTAHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaagggctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccacgcggacaaccgctgcgtgtgggcctcgcggcccgggggcctgctg gctgccgtctcgccgcaggaggtgggcgtgctcaccgggcccgaccggcgcaccttcctg caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcgcgcaccaatgggctggacgcgcgcgccgtgtgtgta ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccacgggggcatc ctcaacaagacggcgcacgagctcatccgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system