Aotus nancymaae (Ma's night monkey): 105727320 Help Entry 105727320         CDS       T10127                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04010   MAPK signaling pathway anan04020   Calcium signaling pathway anan04022   cGMP-PKG signaling pathway anan04114   Oocyte meiosis anan04218   Cellular senescence anan04310   Wnt signaling pathway anan04360   Axon guidance anan04370   VEGF signaling pathway anan04380   Osteoclast differentiation anan04625   C-type lectin receptor signaling pathway anan04650   Natural killer cell mediated cytotoxicity anan04658   Th1 and Th2 cell differentiation anan04659   Th17 cell differentiation anan04660   T cell receptor signaling pathway anan04662   B cell receptor signaling pathway anan04720   Long-term potentiation anan04724   Glutamatergic synapse anan04921   Oxytocin signaling pathway anan04922   Glucagon signaling pathway anan04924   Renin secretion anan05010   Alzheimer disease anan05014   Amyotrophic lateral sclerosis anan05020   Prion disease anan05022   Pathways of neurodegeneration - multiple diseases anan05031   Amphetamine addiction anan05152   Tuberculosis anan05163   Human cytomegalovirus infection anan05166   Human T-cell leukemia virus 1 infection anan05167   Kaposi sarcoma-associated herpesvirus infection anan05170   Human immunodeficiency virus 1 infection anan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer anan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105727320 (PPP3R2)    04310 Wnt signaling pathway     105727320 (PPP3R2)    04370 VEGF signaling pathway     105727320 (PPP3R2)    04020 Calcium signaling pathway     105727320 (PPP3R2)    04022 cGMP-PKG signaling pathway     105727320 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105727320 (PPP3R2)    04218 Cellular senescence     105727320 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105727320 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     105727320 (PPP3R2)    04660 T cell receptor signaling pathway     105727320 (PPP3R2)    04658 Th1 and Th2 cell differentiation     105727320 (PPP3R2)    04659 Th17 cell differentiation     105727320 (PPP3R2)    04662 B cell receptor signaling pathway     105727320 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     105727320 (PPP3R2)    04921 Oxytocin signaling pathway     105727320 (PPP3R2)    04924 Renin secretion     105727320 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     105727320 (PPP3R2)    04720 Long-term potentiation     105727320 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     105727320 (PPP3R2)    04380 Osteoclast differentiation     105727320 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105727320 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105727320 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     105727320 (PPP3R2)    05163 Human cytomegalovirus infection     105727320 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     105727320 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     105727320 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     105727320 (PPP3R2)    05014 Amyotrophic lateral sclerosis     105727320 (PPP3R2)    05020 Prion disease     105727320 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     105727320 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     105727320 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105727320 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:anan01009]     105727320 (PPP3R2) Protein phosphatases and associated proteins [BR:anan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105727320 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  105727320 NCBI-ProteinID:  XP_064232029 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCSHFDNDEIKRLGRSFKKLDLDKSGSLSVEEFMSLPELRDNPLVQR VIDVFDTDGNGEVDFKEFIRGASQFSVRSDEEQKLRFAFSIYDMDEDGYISNGELFQVLK MMVGNNLTDWHLQQLVDKTIIILDRDGDGKISFEEFSAVVRDLEIHKKLVLIM NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacgatgggaaatgaggccagttacccggctgagatgtgctcccactttgacaat gatgaaatcaaaaggctgggcaggagctttaagaagttggacttggacaaatcaggctct ctcagcgtggaggagttcatgtccctgccggagctgcgcgacaacccgttggtgcagcga gtgatcgacgtcttcgacaccgacggcaatggagaggtggacttcaaggaattcatccgg ggggcctcccagttcagcgtcaggagcgacgaggagcagaagctgaggtttgcgttcagc atttacgacatggatgaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgacggactggcatctccagcagctggtcgacaaaaccatc atcatcctggacagggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcatgtga

DBGET integrated database retrieval system