Aotus nancymaae (Ma's night monkey): 105731298 Help Entry 105731298         CDS       T10127                                  Symbol IL2 Name (RefSeq) interleukin-2 precursor   KO K05429   interleukin 2 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04060   Cytokine-cytokine receptor interaction anan04061   Viral protein interaction with cytokine and cytokine receptor anan04151   PI3K-Akt signaling pathway anan04625   C-type lectin receptor signaling pathway anan04630   JAK-STAT signaling pathway anan04658   Th1 and Th2 cell differentiation anan04659   Th17 cell differentiation anan04660   T cell receptor signaling pathway anan04672   Intestinal immune network for IgA production anan04940   Type I diabetes mellitus anan05135   Yersinia infection anan05142   Chagas disease anan05162   Measles anan05166   Human T-cell leukemia virus 1 infection anan05171   Coronavirus disease - COVID-19 anan05200   Pathways in cancer anan05320   Autoimmune thyroid disease anan05321   Inflammatory bowel disease anan05330   Allograft rejection anan05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105731298 (IL2)    04151 PI3K-Akt signaling pathway     105731298 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105731298 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     105731298 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105731298 (IL2)    04660 T cell receptor signaling pathway     105731298 (IL2)    04658 Th1 and Th2 cell differentiation     105731298 (IL2)    04659 Th17 cell differentiation     105731298 (IL2)    04672 Intestinal immune network for IgA production     105731298 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105731298 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105731298 (IL2)    05171 Coronavirus disease - COVID-19     105731298 (IL2)    05162 Measles     105731298 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     105731298 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     105731298 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     105731298 (IL2)    05321 Inflammatory bowel disease     105731298 (IL2)    05330 Allograft rejection     105731298 (IL2)    05332 Graft-versus-host disease     105731298 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105731298 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105731298 (IL2)    00536 Glycosaminoglycan binding proteins [BR:anan00536]     105731298 (IL2) Cytokines and neuropeptides [BR:anan04052]  Cytokines   Interleukins    105731298 (IL2) Glycosaminoglycan binding proteins [BR:anan00536]  Heparan sulfate / Heparin   Cytokines    105731298 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Plasmid_RAQPRD Motif Other DBs NCBI-GeneID:  105731298 NCBI-ProteinID:  NP_001295461 Ensembl:  ENSANAG00000026729 UniProt:  Q7JFM5 LinkDB All DBs AA seq 154 aa AA seqDB search MYRMQLLSCIALSLALITNSAPTSSSTKKTQLQLEHLLLDLQMLLNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTRDIISNINVLVLELKGS ETTFTCEYDDDTATIIEFLNGWITFCQSIISTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcactcatcacaaacagt gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggac ttacagatgcttttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agagataccagggatataatcagcaatatcaacgtactagttctggaactaaagggatct gaaacaacattcacatgtgaatatgatgatgacacagcaaccattatagaatttctgaat ggatggattaccttttgtcaaagcatcatctcaacactaacttga

DBGET integrated database retrieval system