Aotus nancymaae (Ma's night monkey): 105731771 Help Entry 105731771         CDS       T10127                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04382   Cornified envelope formation anan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105731771  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105731771  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105731771 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of microglial cells    105731771 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen IGFL MS_TIM-barrel Motif Other DBs NCBI-GeneID:  105731771 NCBI-ProteinID:  XP_012329078 Ensembl:  ENSANAG00000019767 UniProt:  A0A2K5C4G4 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTLEDLRVLMEKEFPGFLEKQKDPLAMDKIMKDLD QCRDGKVGFQSCFSLIAGLTIACNDCFVVHMKQKGKNQAEMSNSPGPEG NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgtttacatttcacaaatttgct ggggataaaggctacttaacattggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaagcaaaaagaccctctggccatggacaaaataatgaaggacctggac cagtgcagagacggcaaagtgggcttccagagctgcttttccctaattgcgggcctcacc attgcatgcaatgactgttttgtagtacacatgaagcagaagggaaagaaccaggcagaa atgagcaattcccctggccctgaagggtga

DBGET integrated database retrieval system