Aotus nancymaae (Ma's night monkey): 105733842 Help Entry 105733842         CDS       T10127                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04613   Neutrophil extracellular trap formation anan05034   Alcoholism anan05202   Transcriptional misregulation in cancer anan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105733842  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105733842   09163 Immune disease    05322 Systemic lupus erythematosus     105733842   09165 Substance dependence    05034 Alcoholism     105733842  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:anan03036]     105733842   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105733842 Chromosome and associated proteins [BR:anan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105733842 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105733842 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF Motif Other DBs NCBI-GeneID:  105733842 NCBI-ProteinID:  XP_012331934 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MAHTKQTGRKSTSGKTPRKQLATKAARKTVPSTGGVKKPHRYRPGTVALREIRCHQKSTK LLIRKLPFQSLVRKIAQDFKTDLRFQSTAIGALQGASEADLVGPFEDTNLCAIHATRVTI MPKDTQLACHARGEHA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcacacaaagcagactggccgcaaatcaaccagtggtaaaacacccaggaagcaa ctggctacaaaagccgctcgaaagactgtgccctctactggaggggtgaagaaacctcat cgttacaggcctggtacggtggcactgcgtgaaattagatgtcatcagaagtccactaaa cttctgattcgcaaacttcccttccagagtctggtgcgaaaaattgctcaggactttaaa acagatctgcgcttccagagcacagctatcggtgctttgcagggggcaagtgaggccgat ctggttggcccttttgaagacaccaacttgtgtgctatccatgccacacgtgtaacaatt atgccgaaagacacccagctagcatgccacgcacgtggagaacatgcttaa

DBGET integrated database retrieval system