Aotus nancymaae (Ma's night monkey): 110568727 Help Entry 110568727         CDS       T10127                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04613   Neutrophil extracellular trap formation anan05034   Alcoholism anan05202   Transcriptional misregulation in cancer anan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110568727  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110568727   09163 Immune disease    05322 Systemic lupus erythematosus     110568727   09165 Substance dependence    05034 Alcoholism     110568727  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:anan03036]     110568727   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     110568727 Chromosome and associated proteins [BR:anan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110568727 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110568727 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  110568727 NCBI-ProteinID:  XP_021528678 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAGEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLPRRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatccactggtgggaaagccccccgcaaacag ctggccacgaaagccgcccggaaaagcgccccctctaccggcggggtgaagaaacctcat cgctacaggcccgggactgtagcgcttcgagagattcgtcgttaccagaagtcgaccgaa ctgctcatccggaagctacctttccagaggttggtgagggagatcgcgcaggatttcaaa accgacctgaggtttcagagcgctgccatcggtgcgctgcaggaggctggtgaagcgtac ctggtgggtctgttcgaagatactaacctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttgcctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system