Aotus nancymaae (Ma's night monkey): 135269005 Help Entry 135269005         CDS       T10127                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04613   Neutrophil extracellular trap formation anan05034   Alcoholism anan05202   Transcriptional misregulation in cancer anan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:anan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     135269005  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     135269005   09163 Immune disease    05322 Systemic lupus erythematosus     135269005   09165 Substance dependence    05034 Alcoholism     135269005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:anan03036]     135269005   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     135269005 Chromosome and associated proteins [BR:anan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     135269005 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135269005 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  135269005 NCBI-ProteinID:  XP_064218421 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MAHTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDRRFQSAAVGALQKASEAYLVGLFEDTNLCAIHAKRVTI MPKGIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcatacgaagcagactgcccgcaaatctaccggtggtaaagcacccaggaagcaa ttggctaccaaagccgctcggaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccaccgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatcggcgcttccagagcgcagctgtcggtgctttgcagaaggcaagtgaggcctat ctggttggcctttttgaagacacgaacctttgtgctatccatgccaaacgtgtaacaatt atgccaaaaggcatccagctagcacgccgcatacgtggagagcgtgcttaa

DBGET integrated database retrieval system