Aotus nancymaae (Ma's night monkey): 135269961 Help Entry 135269961         CDS       T10127                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan03010   Ribosome anan04120   Ubiquitin mediated proteolysis anan04137   Mitophagy - animal anan04140   Autophagy - animal anan05012   Parkinson disease anan05022   Pathways of neurodegeneration - multiple diseases anan05167   Kaposi sarcoma-associated herpesvirus infection anan05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     135269961   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     135269961  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     135269961    04137 Mitophagy - animal     135269961  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     135269961    05167 Kaposi sarcoma-associated herpesvirus infection     135269961   09164 Neurodegenerative disease    05012 Parkinson disease     135269961    05022 Pathways of neurodegeneration - multiple diseases     135269961  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:anan03011]     135269961    04121 Ubiquitin system [BR:anan04121]     135269961   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     135269961 Ribosome [BR:anan03011]  Ribosomal proteins   Eukaryotes    Small subunit     135269961   Archaea     135269961 Ubiquitin system [BR:anan04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    135269961 Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135269961   Exosomal proteins of colorectal cancer cells    135269961 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Motif Other DBs NCBI-GeneID:  135269961 NCBI-ProteinID:  XP_064220708 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MQSFVKMETTILLNIEPSDTIENVVARTQDKERIPPDQQRLIFAVKQLEDGHTLYDYNIQ EESTLYHVLRFHGGAKKMKKSYTTAKRNMHYRKKVKLAVLKYSKGHDNGKIGCLHRKCLL FECAAGVFMASHFDRHYSGKYCLTASTK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgcagagttttgtaaaaatggagacgaccatccttctcaacattgaaccgtcggataca atagaaaatgtagtggccaggacccaggataaggaaagaattcctcctgaccagcaaaga ctaatctttgctgtcaagcaactggaagatggacatactttgtatgactacaacattcaa gaggagtccactctttatcatgtgttgagatttcatggtggtgctaagaaaatgaagaag tcttacaccactgccaaaaggaatatgcattacagaaagaaggttaagctagctgtcctg aaatactccaaggggcatgacaatggcaaaattggttgccttcataggaagtgcctttta tttgaatgtgctgcaggagtttttatggctagccactttgacaggcattatagtggcaaa tattgtcttactgcttcaacaaaatag

DBGET integrated database retrieval system