Anabaena sp. 90: ANA_C10880 Help Entry ANA_C10880        CDS       T02341                                  Symbol ndhL Name (GenBank) NADH dehydrogenase subunit NdhL   KO K05583   NAD(P)H-quinone oxidoreductase subunit L [EC:7.1.1.2] Organism anb  Anabaena sp. 90 Pathway anb00190   Oxidative phosphorylation anb01100   Metabolic pathways Module anb_M00145   NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria Brite KEGG Orthology (KO) [BR:anb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ANA_C10880 (ndhL) Enzymes [BR:anb01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      ANA_C10880 (ndhL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NdhL Motif Other DBs NCBI-ProteinID:  AFW93672 UniProt:  K7VY27 LinkDB All DBs Position chANA01:complement(941379..941594) Genome browser AA seq 71 aa AA seqDB search MVVALLYLSLAGAYLLVIPIAVFFYLSLRWYTCGSVERVFMYFLVFFFFPGVASSLPVCE FEPPSAKNCLN NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggttgtagcactactgtatctgagtttggctggcgcttatttgctggtaatccccatt gctgtctttttctacttgagtttaagatggtatacctgtggttctgtggaacgggtgttt atgtactttttagtgttctttttctttccaggggttgctagttctctccccgtttgtgaa tttgaacccccgtccgcgaaaaattgcttaaattaa

DBGET integrated database retrieval system