Anabaena sp. 90: ANA_C13815 Help Entry ANA_C13815        CDS       T02341                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism anb  Anabaena sp. 90 Pathway anb00998   Biosynthesis of various antibiotics anb01100   Metabolic pathways anb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:anb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ANA_C13815    00074 Mycolic acid biosynthesis     ANA_C13815   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ANA_C13815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF7127 Motif Other DBs NCBI-ProteinID:  AFW96461 LinkDB All DBs Position chANA01:complement(4325828..4326082) Genome browser AA seq 84 aa AA seqDB search MSQAATFEKVKKIIVEQLSIEDADTVTLEANFVDDLGADSLDTVELVMALEEEFDIDIPD EAAEKIKTVQDTVDYISSHATASP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcagcaacttttgaaaaagttaaaaaaattatcgttgagcaacttagcata gaggatgcggatacggttacactagaagccaattttgttgatgatttaggggctgattcc ctagatacagtggagttagttatggctttggaagaagaatttgatatcgacattcctgat gaagcggctgaaaaaattaaaactgttcaagacactgtggattatatctctagtcacgct actgcatctccatag

DBGET integrated database retrieval system