Ancylobacter sp. TS-1: GBB76_01945 Help Entry GBB76_01945       CDS       T06239                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism anc  Ancylobacter sp. TS-1 Pathway anc01100   Metabolic pathways anc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:anc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBB76_01945    00074 Mycolic acid biosynthesis     GBB76_01945   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBB76_01945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QFR31978 UniProt:  A0A5P8MVR8 LinkDB All DBs Position 399222..399458 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVAEHLGVEPEKVTDNASFIDDLGADSLDTVELVMAFEEAFNVEIPDDAA ETILTVGDAIKFLEKNAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgccgagcgcgtgaagaagattgtagccgagcatctgggcgtcgagccc gagaaggttaccgataatgccagcttcatcgacgatctcggcgccgacagcctcgacacg gtcgagctggtcatggccttcgaagaggccttcaacgtcgagatcccggacgatgccgcc gagacgatcctgaccgtcggcgacgcgatcaagttcctggaaaagaacgcggcctga

DBGET integrated database retrieval system