Ancylobacter sp. TS-1: GBB76_04510 Help Entry GBB76_04510       CDS       T06239                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism anc  Ancylobacter sp. TS-1 Pathway anc02024   Quorum sensing anc03018   RNA degradation Brite KEGG Orthology (KO) [BR:anc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GBB76_04510 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GBB76_04510 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:anc03019]     GBB76_04510 (hfq)    03036 Chromosome and associated proteins [BR:anc03036]     GBB76_04510 (hfq) Messenger RNA biogenesis [BR:anc03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GBB76_04510 (hfq) Chromosome and associated proteins [BR:anc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GBB76_04510 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  QFR32439 LinkDB All DBs Position complement(913576..913827) Genome browser AA seq 83 aa AA seqDB search MAAERSQNLQDTFLNHVRKNKTPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKH AISTIMPGHPVQLFEPDETGEKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccgcggaacgttcgcagaacctccaggacacctttctcaaccacgtccgcaagaac aagacgccgctcaccatctttctggtcaacggtgtgaagctccagggagttgtcacctgg ttcgataatttctgcgtgctgctgcgccgggacggccattcgcagctcgtctacaagcat gccatttcgaccatcatgcccggccatccggttcagcttttcgaaccggacgagaccggc gagaagggctga

DBGET integrated database retrieval system