Ancylobacter sp. TS-1: GBB76_17760 Help Entry GBB76_17760       CDS       T06239                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism anc  Ancylobacter sp. TS-1 Pathway anc01100   Metabolic pathways anc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:anc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBB76_17760    00074 Mycolic acid biosynthesis     GBB76_17760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBB76_17760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QFR34805 LinkDB All DBs Position complement(3772753..3773022) Genome browser AA seq 89 aa AA seqDB search MQTNDPAVAEIVDFISGEVGVDSSLLTADTPVAELGISSLDLIETIFKLESRFGIEIPND GPLSGNDVTVGTLVEHVASLLAAQKAKIA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcagaccaacgatcccgccgtcgccgaaatcgtcgacttcatctccggtgaggtcggg gtcgattcgagcctgctcacggcggacacgccggtcgccgagctcggcatctcctcgctc gacctgatcgagacgatcttcaagttggaaagccgcttcggcatcgagatccccaatgac ggcccgctgagcggcaatgacgtcaccgtcggcacgctggtcgagcacgtcgcctcgctc ctcgccgcgcagaaggccaaaatcgcctga

DBGET integrated database retrieval system