KEGG   Aquipluma nitroreducens: AQPE_1156
Entry
AQPE_1156         CDS       T09507                                 
Name
(GenBank) LSU ribosomal protein L36p
  KO
K02919  large subunit ribosomal protein L36
Organism
anf  Aquipluma nitroreducens
Pathway
anf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:anf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AQPE_1156
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:anf03011]
    AQPE_1156
Ribosome [BR:anf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AQPE_1156
  Bacteria
    AQPE_1156
SSDB
Motif
Pfam: Ribosomal_L36
Other DBs
NCBI-ProteinID: BBE17008
UniProt: A0A5K7S631
LinkDB
Position
complement(1294928..1295044)
AA seq 38 aa
MKVRASIKKRSADCKIVRRKGRLYVINKKNPKYKQRQG
NT seq 117 nt   +upstreamnt  +downstreamnt
atgaaagtaagagcatccattaaaaaacgtagcgccgactgtaaaattgttcgcagaaaa
ggccgtttgtacgtgattaacaaaaagaatccgaagtacaaacaacgtcagggataa

DBGET integrated database retrieval system