Aspergillus niger (black aspergilli): An02g14200 Help Entry An02g14200        CDS       T01030                                  Name (RefSeq) uncharacterized protein   KO K04393   cell division control protein 42 Organism ang  Aspergillus niger (black aspergilli) Pathway ang04011   MAPK signaling pathway - yeast ang04144   Endocytosis ang04517   IgSF CAM signaling ang04518   Integrin signaling ang05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ang00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     An02g14200   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     An02g14200    04518 Integrin signaling     An02g14200  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     An02g14200  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     An02g14200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ang04131]     An02g14200    03036 Chromosome and associated proteins [BR:ang03036]     An02g14200   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ang04147]     An02g14200    04031 GTP-binding proteins [BR:ang04031]     An02g14200 Membrane trafficking [BR:ang04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     An02g14200  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     An02g14200   Macropinocytosis    Ras GTPases     An02g14200 Chromosome and associated proteins [BR:ang03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     An02g14200 Exosome [BR:ang04147]  Exosomal proteins   Exosomal proteins of microglial cells    An02g14200   Exosomal proteins of breast milk    An02g14200 GTP-binding proteins [BR:ang04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     An02g14200 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  4979960 NCBI-ProteinID:  XP_001400551 UniProt:  A0A3F3RHC2 A2QFE0 LinkDB All DBs Position IV AA seq 192 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQTD LRDDPAVREKLARQKMQPIRKEDGDRMAKELGAVKYVECSALTQYKLKDVFDEAIVAALE PAPKKSKKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggttgtggcaacaattaaatgcgttgtcgtcggtgacggtgccgttggcaagacctgc cttttgatctcttacacgacgaacaagttcccttccgaatatgttcccacggtgtttgat aactatgccgtcacagtcatgattggcgatgagccctacactctgggattgtttgatact gctggtcaggaggattacgatcgtcttcgtcctctttcgtatcctcagacggatgtcttc ctcgtttgcttttcggtcacttcgcctgcctcctttgagaacgtacgcgaaaagtggttc cccgaggtgcaccaccactgccccggtgtcccctgcctgatcgtgggcacccaaaccgat cttcgcgacgatcccgctgtccgcgagaagcttgcccgccagaagatgcaaccgattcgc aaagaagatggagaccgtatggccaaggagctgggcgcagtgaaatacgtggagtgttct gccctcacgcagtacaagctcaaggacgtctttgacgaggcgattgttgccgcgctcgag cccgctcctaagaagtcgaagaagtgcgtcctgctgtaa

DBGET integrated database retrieval system