Aspergillus niger (black aspergilli): An07g10020 Help Entry An07g10020        CDS       T01030                                  Name (RefSeq) uncharacterized protein   KO K08341   GABA(A) receptor-associated protein Organism ang  Aspergillus niger (black aspergilli) Pathway ang04136   Autophagy - other ang04138   Autophagy - yeast ang04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:ang00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     An07g10020    04136 Autophagy - other     An07g10020    04139 Mitophagy - yeast     An07g10020  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ang04131]     An07g10020    04121 Ubiquitin system [BR:ang04121]     An07g10020    03029 Mitochondrial biogenesis [BR:ang03029]     An07g10020 Membrane trafficking [BR:ang04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     An07g10020 Ubiquitin system [BR:ang04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    An07g10020 Mitochondrial biogenesis [BR:ang03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     An07g10020 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Hanta_Gn-B Motif Other DBs NCBI-GeneID:  4982271 NCBI-ProteinID:  XP_001392077 UniProt:  A2QPN1 LinkDB All DBs Position IV AA seq 118 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYADRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDC NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgcgttccaagtttaaggacgagcaccccttcgagaagcgcaaggcagaggccgagcgt atccgtcagaaatatgccgatcgcattccagtaatctgcgaaaaggtcgagaaatcggac atcgctaccatcgacaagaagaaatatcttgtccctgccgaccttaccgttgggcagttc gtctacgtgatccgtaagcggattaagctgtcccccgagaaggcgatctttatctttgtc gacgaggttttgccgcctacggccgctctcatgagcagtatctacgaagagcacaaggat gaagatggcttcttgtatatcacgtactccggcgagaatacgtttggtgactgctag

DBGET integrated database retrieval system