Aspergillus niger (black aspergilli): An11g10030 Help Entry An11g10030        CDS       T01030                                  Name (RefSeq) uncharacterized protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ang  Aspergillus niger (black aspergilli) Pathway ang04145   Phagosome ang04148   Efferocytosis ang04620   Toll-like receptor signaling pathway ang05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ang00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     An11g10030    04148 Efferocytosis     An11g10030  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     An11g10030  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     An11g10030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ang04131]     An11g10030   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ang04147]     An11g10030    04031 GTP-binding proteins [BR:ang04031]     An11g10030 Membrane trafficking [BR:ang04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     An11g10030  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     An11g10030   Macropinocytosis    Ras GTPases     An11g10030  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     An11g10030 Exosome [BR:ang04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    An11g10030   Exosomal proteins of other body fluids (saliva and urine)    An11g10030   Exosomal proteins of colorectal cancer cells    An11g10030   Exosomal proteins of bladder cancer cells    An11g10030 GTP-binding proteins [BR:ang04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     An11g10030 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  4985221 NCBI-ProteinID:  XP_059606399 UniProt:  A5ABQ3 LinkDB All DBs Position VII AA seq 192 aa AA seqDB search MATGPATQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVVMVDGRPISLGLWDTAGQ EDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWFPEIEHHAPNVPIILVGTKLDLRD DRGTIDALRQRKMEPVSYEQALAVAKEIRAHKYLECSALTQRNLKSVFDEAIRAVLNPRP AAKPKNKKCVIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggccactggtccagctactcaatccctcaagtgtgtggtgacgggtgatggtgcggta ggaaaaacatgtctcctgatttcgtacacgaccaacgctttccccggcgaatatatccct accgttgtcatggtagatggccgaccgattagcttgggactctgggatactgctggacag gaagattacgaccgtcttcgcccattgtcctacccgcaaaccgacgtcttcctgatctgc ttctccatcgttagcccgccgtcctttgacaacgttaaagccaagtggttcccggagatt gaacaccatgcccccaacgtccccattatcttggtcggcaccaagctcgaccttcgagac gaccgtggtaccatagatgctctccgacagcggaagatggagcccgtctcctacgaacaa gctctggccgtggccaaggaaatccgggcacacaagtacctcgaatgttcggccctgacg cagcgcaacctgaagagtgtattcgacgaggcgattcgcgccgtgctcaatccccggcct gcggccaaaccgaagaacaagaaatgcgtgattctgtag

DBGET integrated database retrieval system