Aspergillus niger (black aspergilli): Asnifp14 Help Entry Asnifp14          CDS       T01030                                  Symbol nad4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism ang  Aspergillus niger (black aspergilli) Pathway ang00190   Oxidative phosphorylation ang01100   Metabolic pathways Module ang_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:ang00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Asnifp14 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ang03029]     Asnifp14 (nad4L) Enzymes [BR:ang01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      Asnifp14 (nad4L) Mitochondrial biogenesis [BR:ang03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     Asnifp14 (nad4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  3703578 NCBI-ProteinID:  YP_337889 UniProt:  Q3LTW8 Q3HM73 LinkDB All DBs AA seq 89 aa AA seqDB search MNFSIFLFLVGILGFVLNRKNIILMLISIEIMLLSITFLILISSLSFDDILGQTFAVYII TVAGAESAIGLGILVAYNRLRGSISIQYR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaatttttcaatttttttatttcttgtaggaatattaggttttgttttaaatagaaaa aatatcatattaatgttaatatcaatagaaattatgttattatcaataacatttttaata ttaataagttcacttagttttgatgatattttaggacaaacttttgctgtatatattata acagtagcaggagcagaatctgcaataggtttaggaattttagttgcatataatagatta agaggaagtatatcaatacaatatagataa

DBGET integrated database retrieval system