Paraurantiacibacter namhicola: A6F65_01223 Help Entry A6F65_01223       CDS       T04447                                  Symbol atpC Name (GenBank) ATP synthase epsilon chain   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism anh  Paraurantiacibacter namhicola Pathway anh00190   Oxidative phosphorylation anh01100   Metabolic pathways Module anh_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:anh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A6F65_01223 (atpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:anh00194]     A6F65_01223 (atpC) Photosynthesis proteins [BR:anh00194]  Photosystem and electron transport system   F-type ATPase [OT]    A6F65_01223 (atpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  ANU07530 UniProt:  A0A1C7D7S2 LinkDB All DBs Position complement(1237249..1237506) Genome browser AA seq 85 aa AA seqDB search MALHFELVTPEKLVRSEDVYMVVVPGAEGEFGVLEGHAPFMSVIRDGAVQVWKTEGGQPE EIAVRGGFAEVGDSGLTVLAEHVEA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccctgcatttcgaactcgtcacgccggagaagctggttcgcagcgaggacgtctac atggtggtcgtccccggtgcggaaggtgaattcggcgtgctggaaggccacgcgcctttc atgtccgtgatccgcgacggcgcggtgcaggtctggaagaccgaaggtggccagccggaa gagatcgccgtgcgcggcggttttgccgaagtcggcgacagcggcctgacggtcctcgcg gaacacgtcgaagcctga

DBGET integrated database retrieval system