Aspergillus nidulans: ANIA_00420 Help Entry ANIA_00420        CDS       T01016                                  Symbol nudG Name (RefSeq) dynein light chain nudG   KO K10418   dynein light chain LC8-type Organism ani  Aspergillus nidulans Pathway ani04145   Phagocytosis ani04517   IgSF CAM signaling ani04814   Motor proteins Brite KEGG Orthology (KO) [BR:ani00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     ANIA_00420 (nudG)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     ANIA_00420 (nudG)   09142 Cell motility    04814 Motor proteins     ANIA_00420 (nudG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ani03037]     ANIA_00420 (nudG)    04812 Cytoskeleton proteins [BR:ani04812]     ANIA_00420 (nudG) Cilium and associated proteins [BR:ani03037]  Motile cilia and associated proteins   Dynein arm    ANIA_00420 (nudG) Cytoskeleton proteins [BR:ani04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      ANIA_00420 (nudG) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF6990 RhoGEF67_u1 SpoIIIAH Motif Other DBs NCBI-GeneID:  2876196 NCBI-ProteinID:  XP_050469229 UniProt:  O94111 LinkDB All DBs Position VIII Genome browser AA seq 94 aa AA seqDB search MASEKKDKLEPQIKSVDMSEDMQQEAVEVAIEAMEKYHIEKDIAQYIKREFDSRKGATWH CVVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcttccgagaagaaggacaagctcgaaccccaaatcaagtccgtcgacatgtcggag gacatgcagcaggaggctgtcgaagttgctatcgaggctatggagaagtatcatattgag aaggacattgctcaatacatcaagagagaatttgactctcgcaaaggcgctacatggcac tgtgtggtgggaaggaactttggaagctttgtgacgcacgaaacgaagcacttcatttac ttctacctcggccactgcgctatccttttattcaagacacaataa

DBGET integrated database retrieval system