Aspergillus nidulans: ANIA_00598 Help Entry ANIA_00598        CDS       T01016                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism ani  Aspergillus nidulans Pathway ani03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ani00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     ANIA_00598  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ani03036]     ANIA_00598    03400 DNA repair and recombination proteins [BR:ani03400]     ANIA_00598 Chromosome and associated proteins [BR:ani03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      ANIA_00598 DNA repair and recombination proteins [BR:ani03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      ANIA_00598 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP HAUS2 TAF TFIID-18kDa Motif Other DBs NCBI-GeneID:  2876376 NCBI-ProteinID:  XP_050469185 UniProt:  C8VSA8 LinkDB All DBs Position VIII:complement(2980143..2980838) Genome browser AA seq 104 aa AA seqDB search MDANENVGLEERLKSALWLSIGKIVDEETIKLGVNATPQFIGALTELVWVQIETASQDLE SFAKHAGRSTINVSDVMMLARRNEGLESILRTYIARLREQENED NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggatgcaaatgagaatgttggcctcgaagagcgcttgaaatccgccctctggctatcc attggaaagattgtggatgaggagacaatcaagctcggtgtgaacgccacacctcagttc attggtgcactgaccgagcttgtctgggttcagatagaaacggcgagtcaagatcttgaa agcttcgcgaagcacgcaggtcggtcaacgatcaatgtatcggatgtgatgatgctggca cgccgaaacgaaggactcgagtctatattaagaacatatatcgctcgactacgtgagcaa gaaaacgaagactga

DBGET integrated database retrieval system