Aspergillus nidulans: ANIA_10963 Help Entry ANIA_10963        CDS       T01016                                  Name (RefSeq) hypothetical protein   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism ani  Aspergillus nidulans Pathway ani03018   RNA degradation ani03040   Spliceosome Brite KEGG Orthology (KO) [BR:ani00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     ANIA_10963   09123 Folding, sorting and degradation    03018 RNA degradation     ANIA_10963  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ani03019]     ANIA_10963    03041 Spliceosome [BR:ani03041]     ANIA_10963 Messenger RNA biogenesis [BR:ani03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      ANIA_10963   mRNA degradation factors    5'-3' decay     Lsm complex      ANIA_10963 Spliceosome [BR:ani03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     ANIA_10963  Complex C   U2 snRNP components     ANIA_10963 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM LRR_9 Hfq Motif Other DBs NCBI-GeneID:  74896702 NCBI-ProteinID:  XP_050467988 UniProt:  C8VBS9 LinkDB All DBs Position IV:2004660..2005309 Genome browser AA seq 98 aa AA seqDB search MLFFSFFKTLTNQVVTIELKNDIRIRGTLKSVDQYLNIKLDDIDVLDLDKYPHLSSVKNM FIRGSVVRYVVLPRSEVDVGLLEDATRREAANQAGKAR NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgctctttttcagctttttcaagaccctaacgaaccaagtcgtgacaatagagctcaag aatgatatccgtatccgcgggacgctcaagtccgtcgaccagtacctgaacattaaactc gacgatatcgacgttctagacctcgataaatatccacatctcagctccgtcaagaacatg tttattcgagggagtgtagtgcggtatgtggttttgccgcggtcggaagttgatgtgggt ttgttggaggatgcgacgcggagagaagctgcgaaccaggcagggaaggctcggtga

DBGET integrated database retrieval system