Aspergillus nidulans: ANIA_11406 Help Entry ANIA_11406        CDS       T01016                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism ani  Aspergillus nidulans Pathway ani03020   RNA polymerase ani03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ani00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     ANIA_11406   09124 Replication and repair    03420 Nucleotide excision repair     ANIA_11406  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ani03021]     ANIA_11406    03400 DNA repair and recombination proteins [BR:ani03400]     ANIA_11406 Transcription machinery [BR:ani03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      ANIA_11406   RNA polymerase III system    RNA polymerase III      ANIA_11406   RNA polymerase I system    RNA polymerase I      ANIA_11406 DNA repair and recombination proteins [BR:ani03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       ANIA_11406 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD DUF2197 zinc-ribbon_6 DUF5816 DZR HypA DZR_2 zinc-ribbons_6 Zn-ribbon_8 FtrD-like YjdM_Zn_Ribbon Motif Other DBs NCBI-GeneID:  74896997 NCBI-ProteinID:  XP_050467510 LinkDB All DBs Position II:complement(3474048..3474330) Genome browser AA seq 75 aa AA seqDB search MSREAYQVPSLGGGNAFSNDNLGAGSLDGPIVAYLCGDCNARVSLKRGDQIRCKECGHRV LYKERTKRMVQFEAR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcccgtgaagcctaccaagtcccctccctcggcggcggcaatgctttcagcaacgac aacctcggtgcgggttctctcgacggtcctatcgtcgcctacctgtgcggtgactgcaac gcccgtgtgtcactcaagcgaggcgatcagatccgctgcaaggagtgtggacatcgtgtt ttatacaaggagcggacgaagcgaatggttcagttcgaggcgcgatag

DBGET integrated database retrieval system