Anopheles nili: 128730244 Help Entry 128730244         CDS       T11473                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism anil  Anopheles nili Pathway anil04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:anil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128730244  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:anil04121]     128730244    03400 DNA repair and recombination proteins [BR:anil03400]     128730244 Ubiquitin system [BR:anil04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      128730244    Cul5 complex      128730244 DNA repair and recombination proteins [BR:anil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128730244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  128730244 NCBI-ProteinID:  XP_053679254 LinkDB All DBs Position 2:complement(45932886..45935112) Genome browser AA seq 117 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTLVYELKKMIEGILKVPPRDQRLYNKDNMLMEDEKTLQD CGIMVVTAKAQCPAQLGLAVRENGDFESLELTPYSLPPDLPDVMKNQDTANGQDQLA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtttttatgatgatcagaagaaagaagacgacgatttttaccgatgccaaagaa acaacactggtgtacgagctgaaaaagatgattgaaggaatacttaaagtgcctccccgt gaccaacggctttacaacaaagacaacatgctaatggaggacgaaaaaacattgcaggac tgtgggattatggtagttacggcgaaagcacaatgtccagcacagcttggcttggccgta cgtgaaaatggagattttgaatcgcttgagctgacgccatactctctaccaccggatcta ccggacgtgatgaaaaaccaggacacagcaaacggccaagatcaactggcctaa

DBGET integrated database retrieval system