KEGG   Anaeromyxobacter sp. K: AnaeK_0871
Entry
AnaeK_0871        CDS       T00748                                 
Name
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00630  Glyoxylate and dicarboxylate metabolism
ank00680  Methane metabolism
ank01100  Metabolic pathways
ank01120  Microbial metabolism in diverse environments
ank01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ank00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AnaeK_0871
  09102 Energy metabolism
   00680 Methane metabolism
    AnaeK_0871
SSDB
Motif
Pfam: Fer4_11 Fer4_7 Fer4_6 Fer4_9 Fer4 Fer4_2 Fer4_10 Fer4_16 Fer4_21 Fer4_4 Fer4_3 Fer4_8 Fer4_15 AFOR_C
Other DBs
NCBI-ProteinID: ACG72107
LinkDB
Position
complement(994536..995468)
AA seq 310 aa
MQEMGFFTDTTLCIGCKACEVACKQWNQLPDDGFSLTGMSYDNTGTLGASTWRHVAFVER
TEPLPGQGSPRDGIEAGAGAFAELRPLGQPAPTSLLHDLAPTHLADVPVALGPSQQALGK
FAWLMMSDVCKHCERAGCLEACPTGAILRTEFGSVYIQPDVCNGCGYCVSACPFGVVDRR
EDDGRAWKCTLCYDRLEGGMVPACAKACPTASIQFGSLADLRERARNRVEQLRARGVADA
RLYGETAESQPGTEGLHAFFLLCDRPEVYGLPPDPVVPTAKIVASWRAMATGVLSLAALA
LGAVLSARRA
NT seq 933 nt   +upstreamnt  +downstreamnt
gtgcaggagatggggttcttcaccgacacgacgctctgcatcggctgcaaggcctgcgag
gtcgcgtgcaagcagtggaaccagctccccgacgacggcttctcgctgaccgggatgagc
tacgacaacaccggcaccctgggcgcgtccacctggcggcacgtcgcgttcgtcgagcgg
accgagccgctgcccggccagggcagcccgcgcgacgggatcgaggcgggcgcgggcgcg
ttcgccgagctccggccgctcggccagcccgcgccgacgtcgctgctccacgacctggcc
cccacccacctcgccgacgtgccggtcgcgctcggcccgtcgcagcaggcgctcgggaag
ttcgcctggctgatgatgagcgacgtctgcaagcactgcgagcgcgccgggtgcctggag
gcgtgccccaccggcgcgatcctccgcaccgagttcggctcggtgtacatccagccggac
gtctgcaacggctgcggctactgcgtgtcggcctgtccgttcggcgtggtggaccggcgc
gaggacgacgggcgcgcctggaagtgcacgctctgctacgaccggctcgagggcggcatg
gtgccggcctgcgccaaggcctgccccaccgcctcgatccagttcggctcgctcgcggac
ctgcgcgagcgggcccggaaccgggtcgagcagctccgcgcgcgcggcgtcgccgacgcc
cgcctgtacggcgagaccgcggagagccagcccgggaccgaggggctgcacgcgttcttc
ctgctctgcgaccggcccgaggtgtacgggctcccgccggatccggtggtgccgaccgcg
aagatcgtggccagctggcgcgccatggccacgggggtgctgtcgctcgcggcgctggcg
ctcggggcggtgctctcggcgaggagggcgtga

DBGET integrated database retrieval system