Anaeromyxobacter sp. K: AnaeK_2288 Help Entry AnaeK_2288        CDS       T00748                                  Name (GenBank) Septum formation initiator   KO K05589   cell division protein FtsB Organism ank  Anaeromyxobacter sp. K Brite KEGG Orthology (KO) [BR:ank00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ank03036]     AnaeK_2288 Chromosome and associated proteins [BR:ank03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AnaeK_2288 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC FAZ1_C ADIP ZapB HALZ bZIP_1 Rootletin Golgin_A5 NRBF2 INO80F SOGA APG6_N Ax_dynein_light DUF7491 DUF3287 CENP-F_leu_zip XRCC4_CC Spc24 Motif Other DBs NCBI-ProteinID:  ACG73515 UniProt:  B4UDU9 LinkDB All DBs Position complement(2571765..2572064) Genome browser AA seq 99 aa AA seqDB search MAVTRGRRWGVYVGVVALLAALSAADPSGLRKHLRLAGEVDQMRAENERLAAENARLARE VRALRSEPAALERAVREELRYIRPGERVYWLGAERGGAP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggccgtgacgcgcggacgcaggtggggcgtgtacgtgggggtcgtcgccttgctggcg gccctctccgccgccgatccgtccggcctccggaagcacctgcgcctcgccggcgaggtg gaccagatgcgcgccgagaacgagcgcctggcggccgagaacgcccgactcgcgcgcgag gtccgggcgctccgctccgagccggccgcgctggagcgcgccgtgcgcgaggagctccgg tacatccgcccgggcgagcgggtctactggctgggcgccgagcgcggaggggccccgtga

DBGET integrated database retrieval system