KEGG   Anoxybacillus sp. B7M1: GFC29_1949
Entry
GFC29_1949        CDS       T04426                                 
Symbol
ilvB
Name
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00290  Valine, leucine and isoleucine biosynthesis
anl00650  Butanoate metabolism
anl00660  C5-Branched dibasic acid metabolism
anl00770  Pantothenate and CoA biosynthesis
anl01100  Metabolic pathways
anl01110  Biosynthesis of secondary metabolites
anl01210  2-Oxocarboxylic acid metabolism
anl01230  Biosynthesis of amino acids
Module
anl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
anl_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GFC29_1949 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    GFC29_1949 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    GFC29_1949 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    GFC29_1949 (ilvB)
Enzymes [BR:anl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     GFC29_1949 (ilvB)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N POR_N CO_dh SRP54
Other DBs
NCBI-ProteinID: ANB63147
LinkDB
Position
complement(1975474..1977207)
AA seq 577 aa
MANMKVEEKRKQKMKISGALMLIEALKAEKVEVIFGYPGGAVLPIYDKLYDSGIFHVLTR
HEQGAIHAAEGYARISGKPGVVIATSGPGATNIVTGLTDAMMDSLPLVVFTGQVASGVIG
SDAFQEADVVGITMPITKHSYQVRHVQELPKIIKEAFHIATTGRPGPVLIDIPKDMTTQE
GEFDYEQPVRLPGYQPTVYPNHLQIRKLVEAVSQAKRPVILAGAGVLHANASQELQQYAE
QQKIPVIHTLLGLGGFPADHPLFLGMAGMHGTYTANMALYECDLLINIGARFDDRVTGNL
NCFAPKATVAHIDIDPAEIGKNVPTKIPIVSDAKEALKELILQEGRPADTDEWLAQLAEW
KKGFPLVYKNEPRTMKPQKLIEMIYELTDGEAIVTTDVGQHQMWTAQYYKFNQPNRWVTS
GGLGTMGFGLPAAIGAQLADRQATVVSIVGDGGFQMTLQELSVIQELKLPIKVVIVNNQS
LGMVRQWQQLFYEKRYSHSLIPNQPDFVKLAEAYNIKGLRAKTEAEAVRVLQQAFSLHEP
VLLDIHVAADENVYPMVAPGKGLHEMVGVKLCEESLQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggcaaacatgaaagtcgaggagaaaaggaagcaaaaaatgaaaataagcggagcatta
atgctgatagaggcattaaaagcagagaaagtagaagtgatctttggatatccaggagga
gcggtattgccgatttacgacaaattgtatgattcaggcattttccatgttttaacgcgc
cacgaacaaggagccattcatgcagcagaaggctatgcccgcatttctggaaaaccaggg
gttgtcattgcgacgtccggtcctggagcaacaaacattgtgacaggcttaacagatgcg
atgatggattcgttgccgttggttgtttttactggccaagtagcgtcaggagtcatcggt
tctgatgcctttcaagaagcagatgttgttggaattaccatgccgatcacgaagcacagc
taccaagttcgccatgtccaggagcttccgaagattattaaagaagcatttcatattgcg
acaacagggcggccaggaccagtactgattgatattccaaaggatatgacgacccaagaa
ggagaatttgattatgaacagcctgttcgtcttcctggatatcagccaaccgtttatcct
aaccatttgcaaattcgcaagctggttgaagcagtgagccaagccaaacgcccagtcatt
ttagcgggagcgggcgtattgcatgccaatgcatctcaagagctgcagcaatatgcggag
cagcaaaaaatccccgtcatccatacgttgctgggactcggaggctttccggcagaccat
ccactttttctgggcatggcggggatgcacggaacgtatacagcgaatatggccttatac
gaatgtgatttattaatcaatatcggcgcccgttttgatgatcgtgtgactggaaattta
aactgttttgctccgaaagcaacggtggcgcacattgatatcgatccagcggaaatcggc
aaaaatgtgccaacaaaaatcccgattgtgagcgacgcgaaagaggcactaaaagagctg
attcttcaagaaggaaggccggctgatacagatgaatggcttgcacagttagcagaatgg
aaaaaaggatttccgctcgtttataaaaatgagcctagaacgatgaagccgcagaagtta
attgagatgatttatgagctcacagatggagaagccattgtgaccacggatgtagggcag
catcaaatgtggactgcgcagtattacaagttcaaccagccaaaccgttgggttacttca
ggagggctcggcacgatggggtttgggcttccggcggcgattggggcacagttagccgat
cggcaagcgactgttgtttcgattgtcggcgatggcggatttcaaatgacgttgcaagag
ctatcggttattcaagaattgaagctgccgattaaagtggtgattgtgaacaatcaatcg
ctcggcatggtgcggcagtggcagcagctcttttacgaaaagcgatactcgcactcgctc
attccgaaccagccggattttgtcaaactggccgaggcttacaatataaagggattgcgg
gcgaaaacagaagcggaagctgtccgcgtattacagcaagctttttcccttcacgaacca
gtattgctcgatattcacgtagcggcggatgaaaatgtatatccaatggtggcgccagga
aagggcctgcatgaaatggtgggggtgaaattgtgcgaagaatcattacaatga

DBGET integrated database retrieval system