Anoxybacillus sp. B7M1: GFC29_2614 Help Entry GFC29_2614        CDS       T04426                                  Symbol atpE Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism anl  Anoxybacillus sp. B7M1 Pathway anl00190   Oxidative phosphorylation anl01100   Metabolic pathways Module anl_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:anl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GFC29_2614 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:anl00194]     GFC29_2614 (atpE) Photosynthesis proteins [BR:anl00194]  Photosystem and electron transport system   F-type ATPase [OT]    GFC29_2614 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ANB62696 UniProt:  A0A160F7Q1 LinkDB All DBs Position complement(2655927..2656139) Genome browser AA seq 70 aa AA seqDB search MGVLAAAIAIGLAALGAGIGNGLIVSRTVEGIARQPEARGMLQTTMFIGVALVEAIPIIA VVIAFMVLGR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgggtgtattagcagctgcaattgctatcggtttagctgcacttggtgcaggtattggt aacggtttaatcgtatctcgtacagtggaggggattgctcgccaaccagaggcgcgcggt atgcttcaaacgacaatgtttatcggtgttgcgttagtagaggcaattccaattatcgca gttgttattgccttcatggttttaggacgataa

DBGET integrated database retrieval system