Anoxybacillus sp. B7M1: GFC29_361 Help Entry GFC29_361         CDS       T04426                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism anl  Anoxybacillus sp. B7M1 Pathway anl01100   Metabolic pathways anl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:anl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GFC29_361 (acpP)    00074 Mycolic acid biosynthesis     GFC29_361 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GFC29_361 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  ANB62688 UniProt:  A0A160F7V2 LinkDB All DBs Position 364239..364472 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEESQVTLEASFKDDLGADSLDVVELVMELEDEFDMEISDEEA EKIVTVGDAVNYIKSRM NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggcagatgtattagagcgcgtaacgaaaatcatcgttgaccgcttaggcgtggaggag tctcaagtaacacttgaagcttctttcaaagatgatttaggtgctgattcattagatgtg gttgaacttgtcatggaactagaagacgagtttgatatggaaatttccgatgaggaagca gaaaaaattgtcacagtaggagatgctgtgaactacataaaaagtcgcatgtaa

DBGET integrated database retrieval system