Antarcticibacterium arcticum: FK178_00500
Help
Entry
FK178_00500 CDS
T06142
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
anp
Antarcticibacterium arcticum
Pathway
anp00770
Pantothenate and CoA biosynthesis
anp01100
Metabolic pathways
anp01240
Biosynthesis of cofactors
Module
anp_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
anp00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
FK178_00500 (coaD)
Enzymes [BR:
anp01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
FK178_00500 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
QED36301
UniProt:
A0A5B8YFG0
LinkDB
All DBs
Position
complement(119257..119718)
Genome browser
AA seq
153 aa
AA seq
DB search
MKIAVFPGSYDPITLGHVDIIERALPLFDKIILAIGVNADKKYMFPLVDRVKFLEETFEE
ETKIEVMTYKGLTVDFCKEENAGFILRGLRNVIDLEFEKTIGQTNFKMAGIETVFLIASS
GKEHISSTVVRDVRKNGGDFAFMVPGPVSRYDL
NT seq
462 nt
NT seq
+upstream
nt +downstream
nt
atgaaaatagccgttttccccggatcttatgatcccattacccttgggcacgtagatatt
attgaacgcgcacttcccctttttgacaagatcatcctggctattggagtaaatgccgat
aaaaaatatatgtttcccctggtagacagggtaaagtttctggaagaaacttttgaagaa
gaaaccaaaattgaagtgatgacctataaaggtttaactgttgatttttgtaaggaagaa
aatgcaggttttattttacgcggattaaggaatgtaatagaccttgaatttgaaaagacc
attggccagactaatttcaaaatggcagggatagaaaccgtatttttgatagcttcatct
ggcaaagagcatatatcctcgactgtggtgagagatgtaagaaaaaacggcggggatttt
gcctttatggttcccgggcctgtgagccgttacgacctttaa
DBGET
integrated database retrieval system