Antarcticibacterium arcticum: FK178_12555 Help Entry FK178_12555       CDS       T06142                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism anp  Antarcticibacterium arcticum Pathway anp00190   Oxidative phosphorylation anp01100   Metabolic pathways Module anp_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:anp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FK178_12555 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:anp00194]     FK178_12555 (atpE) Photosynthesis proteins [BR:anp00194]  Photosystem and electron transport system   F-type ATPase [OT]    FK178_12555 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C OPT Motif Other DBs NCBI-ProteinID:  QED38493 UniProt:  A0A5B8YPD8 LinkDB All DBs Position 2775315..2775545 Genome browser AA seq 76 aa AA seqDB search MEYLHIGLAALGAGLAVIGAAIGVGRIGGSAMDAIARQPEASGKIQTAMIIAAALVEGVA LFGVVAALLGVLTVPA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggagtatttacacattggacttgcagcattaggagctggtcttgcagttattggagct gctattggggttggtagaattggtggatctgcaatggatgctatcgctcgccagccagaa gcttctggaaagatccagactgctatgattattgctgcggctcttgtagagggtgttgcc ctttttggagttgttgctgcattattaggggtacttacagtaccggcttag

DBGET integrated database retrieval system