Arcobacter nitrofigilis: Arnit_0496 Help Entry Arnit_0496        CDS       T01235                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ant  Arcobacter nitrofigilis Pathway ant00998   Biosynthesis of various antibiotics ant01100   Metabolic pathways ant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Arnit_0496    00074 Mycolic acid biosynthesis     Arnit_0496   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Arnit_0496 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ADG92161 UniProt:  D5UZC4 LinkDB All DBs Position complement(483150..483380) Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVVEQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE KILTVSDAIKYIEDNK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtgaaagaagtagtagttgagcaattagattgcgatccagct gaagttaaagaagattcaaaattcattgaagacttaggggcagattcgttagacgttgtt gagctagttatggctttagaagaaaaatttgacatcgaaatacctgatgaagatgcggaa aaaatcttaactgtttcagatgctatcaaatacatcgaagataataaataa

DBGET integrated database retrieval system