Arvicanthis niloticus (African grass rat): 117706169
Help
Entry
117706169 CDS
T08817
Symbol
Cd70
Name
(RefSeq) CD70 antigen
KO
K05470
tumor necrosis factor ligand superfamily member 7
Organism
anu
Arvicanthis niloticus (African grass rat)
Pathway
anu04060
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:
anu00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
117706169 (Cd70)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
anu04052
]
117706169 (Cd70)
04090 CD molecules [BR:
anu04090
]
117706169 (Cd70)
Cytokines and neuropeptides [BR:
anu04052
]
Cytokines
Tumor necrosis fators
117706169 (Cd70)
CD molecules [BR:
anu04090
]
Proteins
117706169 (Cd70)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TNF
Motif
Other DBs
NCBI-GeneID:
117706169
NCBI-ProteinID:
XP_034354922
LinkDB
All DBs
Position
3:complement(138154017..138157672)
Genome browser
AA seq
194 aa
AA seq
DB search
MPEEGRPYPWIRWSGTALQRLLPWLLVVFIIAICCWFHCGGHLSKQQQRLQEPLKMHVAE
LQLNLTDPRKDPTLHWGAGPALGRSFTHGPELENGQLRICLDGIYRLHIQVTLANCSSSG
SSLQHRATLAVGICSPAAHSISLGRRRFGQDCTVALQRLTPLARGDVICTNVTLPLLPSR
NADETFFGVQWIHP
NT seq
585 nt
NT seq
+upstream
nt +downstream
nt
atgccggaggaaggccgcccttacccctggatacgctggagcggaaccgcgctccagcgc
ctgctgccatggctgctggtggtgtttattattgcgatttgctgttggttccactgtggt
gggcacctcagtaagcagcaacagaggctgcaggagccacttaagatgcacgtagctgag
ttacagctgaatctcacagatcctcggaaggaccccacactgcactggggagccggccca
gccttgggaagatccttcacgcatggaccagaactggagaatggccaacttcgtatctgt
ctagatggcatctacaggctgcatatccaggtgacactggccaactgctcttcctcaggc
agctccctgcagcacagggccaccctggctgtgggcatctgctcccctgctgctcacagc
atcagcttggggcgtcggcgcttcggacaggactgtacagtggcattacagcgcctgaca
cccctggcccgcggagatgtcatctgcaccaacgttaccctgcctctgctgccatcccga
aatgctgatgagactttctttggagttcagtggatacacccttga
DBGET
integrated database retrieval system