KEGG   Arvicanthis niloticus (African grass rat): 117706966
Entry
117706966         CDS       T08817                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
anu  Arvicanthis niloticus (African grass rat)
Pathway
anu01521  EGFR tyrosine kinase inhibitor resistance
anu01522  Endocrine resistance
anu04010  MAPK signaling pathway
anu04012  ErbB signaling pathway
anu04014  Ras signaling pathway
anu04015  Rap1 signaling pathway
anu04062  Chemokine signaling pathway
anu04068  FoxO signaling pathway
anu04071  Sphingolipid signaling pathway
anu04072  Phospholipase D signaling pathway
anu04137  Mitophagy - animal
anu04140  Autophagy - animal
anu04150  mTOR signaling pathway
anu04151  PI3K-Akt signaling pathway
anu04210  Apoptosis
anu04211  Longevity regulating pathway
anu04213  Longevity regulating pathway - multiple species
anu04218  Cellular senescence
anu04360  Axon guidance
anu04370  VEGF signaling pathway
anu04371  Apelin signaling pathway
anu04540  Gap junction
anu04550  Signaling pathways regulating pluripotency of stem cells
anu04625  C-type lectin receptor signaling pathway
anu04650  Natural killer cell mediated cytotoxicity
anu04660  T cell receptor signaling pathway
anu04662  B cell receptor signaling pathway
anu04664  Fc epsilon RI signaling pathway
anu04714  Thermogenesis
anu04720  Long-term potentiation
anu04722  Neurotrophin signaling pathway
anu04725  Cholinergic synapse
anu04726  Serotonergic synapse
anu04730  Long-term depression
anu04810  Regulation of actin cytoskeleton
anu04910  Insulin signaling pathway
anu04912  GnRH signaling pathway
anu04915  Estrogen signaling pathway
anu04916  Melanogenesis
anu04917  Prolactin signaling pathway
anu04919  Thyroid hormone signaling pathway
anu04921  Oxytocin signaling pathway
anu04926  Relaxin signaling pathway
anu04929  GnRH secretion
anu04933  AGE-RAGE signaling pathway in diabetic complications
anu04935  Growth hormone synthesis, secretion and action
anu05010  Alzheimer disease
anu05022  Pathways of neurodegeneration - multiple diseases
anu05034  Alcoholism
anu05160  Hepatitis C
anu05161  Hepatitis B
anu05163  Human cytomegalovirus infection
anu05165  Human papillomavirus infection
anu05166  Human T-cell leukemia virus 1 infection
anu05167  Kaposi sarcoma-associated herpesvirus infection
anu05170  Human immunodeficiency virus 1 infection
anu05200  Pathways in cancer
anu05203  Viral carcinogenesis
anu05205  Proteoglycans in cancer
anu05206  MicroRNAs in cancer
anu05207  Chemical carcinogenesis - receptor activation
anu05208  Chemical carcinogenesis - reactive oxygen species
anu05210  Colorectal cancer
anu05211  Renal cell carcinoma
anu05213  Endometrial cancer
anu05214  Glioma
anu05215  Prostate cancer
anu05216  Thyroid cancer
anu05218  Melanoma
anu05219  Bladder cancer
anu05220  Chronic myeloid leukemia
anu05221  Acute myeloid leukemia
anu05223  Non-small cell lung cancer
anu05224  Breast cancer
anu05225  Hepatocellular carcinoma
anu05226  Gastric cancer
anu05230  Central carbon metabolism in cancer
anu05231  Choline metabolism in cancer
anu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
anu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:anu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    117706966 (Nras)
   04012 ErbB signaling pathway
    117706966 (Nras)
   04014 Ras signaling pathway
    117706966 (Nras)
   04015 Rap1 signaling pathway
    117706966 (Nras)
   04370 VEGF signaling pathway
    117706966 (Nras)
   04371 Apelin signaling pathway
    117706966 (Nras)
   04068 FoxO signaling pathway
    117706966 (Nras)
   04072 Phospholipase D signaling pathway
    117706966 (Nras)
   04071 Sphingolipid signaling pathway
    117706966 (Nras)
   04151 PI3K-Akt signaling pathway
    117706966 (Nras)
   04150 mTOR signaling pathway
    117706966 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117706966 (Nras)
   04137 Mitophagy - animal
    117706966 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    117706966 (Nras)
   04218 Cellular senescence
    117706966 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    117706966 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    117706966 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117706966 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117706966 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    117706966 (Nras)
   04660 T cell receptor signaling pathway
    117706966 (Nras)
   04662 B cell receptor signaling pathway
    117706966 (Nras)
   04664 Fc epsilon RI signaling pathway
    117706966 (Nras)
   04062 Chemokine signaling pathway
    117706966 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    117706966 (Nras)
   04929 GnRH secretion
    117706966 (Nras)
   04912 GnRH signaling pathway
    117706966 (Nras)
   04915 Estrogen signaling pathway
    117706966 (Nras)
   04917 Prolactin signaling pathway
    117706966 (Nras)
   04921 Oxytocin signaling pathway
    117706966 (Nras)
   04926 Relaxin signaling pathway
    117706966 (Nras)
   04935 Growth hormone synthesis, secretion and action
    117706966 (Nras)
   04919 Thyroid hormone signaling pathway
    117706966 (Nras)
   04916 Melanogenesis
    117706966 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    117706966 (Nras)
   04726 Serotonergic synapse
    117706966 (Nras)
   04720 Long-term potentiation
    117706966 (Nras)
   04730 Long-term depression
    117706966 (Nras)
   04722 Neurotrophin signaling pathway
    117706966 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    117706966 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    117706966 (Nras)
   04213 Longevity regulating pathway - multiple species
    117706966 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    117706966 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117706966 (Nras)
   05206 MicroRNAs in cancer
    117706966 (Nras)
   05205 Proteoglycans in cancer
    117706966 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    117706966 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    117706966 (Nras)
   05203 Viral carcinogenesis
    117706966 (Nras)
   05230 Central carbon metabolism in cancer
    117706966 (Nras)
   05231 Choline metabolism in cancer
    117706966 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    117706966 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    117706966 (Nras)
   05225 Hepatocellular carcinoma
    117706966 (Nras)
   05226 Gastric cancer
    117706966 (Nras)
   05214 Glioma
    117706966 (Nras)
   05216 Thyroid cancer
    117706966 (Nras)
   05221 Acute myeloid leukemia
    117706966 (Nras)
   05220 Chronic myeloid leukemia
    117706966 (Nras)
   05218 Melanoma
    117706966 (Nras)
   05211 Renal cell carcinoma
    117706966 (Nras)
   05219 Bladder cancer
    117706966 (Nras)
   05215 Prostate cancer
    117706966 (Nras)
   05213 Endometrial cancer
    117706966 (Nras)
   05224 Breast cancer
    117706966 (Nras)
   05223 Non-small cell lung cancer
    117706966 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    117706966 (Nras)
   05170 Human immunodeficiency virus 1 infection
    117706966 (Nras)
   05161 Hepatitis B
    117706966 (Nras)
   05160 Hepatitis C
    117706966 (Nras)
   05163 Human cytomegalovirus infection
    117706966 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117706966 (Nras)
   05165 Human papillomavirus infection
    117706966 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117706966 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    117706966 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    117706966 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117706966 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    117706966 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    117706966 (Nras)
   01522 Endocrine resistance
    117706966 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:anu04131]
    117706966 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anu04147]
    117706966 (Nras)
   04031 GTP-binding proteins [BR:anu04031]
    117706966 (Nras)
Membrane trafficking [BR:anu04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    117706966 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    117706966 (Nras)
Exosome [BR:anu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117706966 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   117706966 (Nras)
  Exosomal proteins of breast cancer cells
   117706966 (Nras)
  Exosomal proteins of colorectal cancer cells
   117706966 (Nras)
GTP-binding proteins [BR:anu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    117706966 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 117706966
NCBI-ProteinID: XP_034356087
LinkDB
Position
4:82109889..82119401
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLSSSDDGTQG
CLGLPCVLM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgaca
atccagctaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtgattgacggtgagacctgtctgctggacatactggacacagctgga
caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaagggttcctctgt
gtatttgccatcaataatagcaaatcctttgcagatattaacctctacagggagcagatt
aagcgtgtgaaagactctgatgacgtgcccatggtgctggtagggaacaagtgtgacttg
ccaacaaggacagtcgatacaaagcaagcccacgagctggccaagagctacggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaagatgccttttacacactcgtg
agggagatacgccagtaccgaatgaagaagctcagcagcagtgatgacggcactcaaggt
tgtctggggctgccctgtgtgctgatgtag

DBGET integrated database retrieval system