KEGG   Arvicanthis niloticus (African grass rat): 117717711
Entry
117717711         CDS       T08817                                 
Symbol
Mapk1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
anu  Arvicanthis niloticus (African grass rat)
Pathway
anu01521  EGFR tyrosine kinase inhibitor resistance
anu01522  Endocrine resistance
anu01524  Platinum drug resistance
anu04010  MAPK signaling pathway
anu04012  ErbB signaling pathway
anu04014  Ras signaling pathway
anu04015  Rap1 signaling pathway
anu04022  cGMP-PKG signaling pathway
anu04024  cAMP signaling pathway
anu04062  Chemokine signaling pathway
anu04066  HIF-1 signaling pathway
anu04068  FoxO signaling pathway
anu04071  Sphingolipid signaling pathway
anu04072  Phospholipase D signaling pathway
anu04114  Oocyte meiosis
anu04140  Autophagy - animal
anu04148  Efferocytosis
anu04150  mTOR signaling pathway
anu04151  PI3K-Akt signaling pathway
anu04210  Apoptosis
anu04218  Cellular senescence
anu04261  Adrenergic signaling in cardiomyocytes
anu04270  Vascular smooth muscle contraction
anu04350  TGF-beta signaling pathway
anu04360  Axon guidance
anu04370  VEGF signaling pathway
anu04371  Apelin signaling pathway
anu04380  Osteoclast differentiation
anu04510  Focal adhesion
anu04520  Adherens junction
anu04540  Gap junction
anu04550  Signaling pathways regulating pluripotency of stem cells
anu04611  Platelet activation
anu04613  Neutrophil extracellular trap formation
anu04620  Toll-like receptor signaling pathway
anu04621  NOD-like receptor signaling pathway
anu04625  C-type lectin receptor signaling pathway
anu04650  Natural killer cell mediated cytotoxicity
anu04657  IL-17 signaling pathway
anu04658  Th1 and Th2 cell differentiation
anu04659  Th17 cell differentiation
anu04660  T cell receptor signaling pathway
anu04662  B cell receptor signaling pathway
anu04664  Fc epsilon RI signaling pathway
anu04666  Fc gamma R-mediated phagocytosis
anu04668  TNF signaling pathway
anu04713  Circadian entrainment
anu04720  Long-term potentiation
anu04722  Neurotrophin signaling pathway
anu04723  Retrograde endocannabinoid signaling
anu04724  Glutamatergic synapse
anu04725  Cholinergic synapse
anu04726  Serotonergic synapse
anu04730  Long-term depression
anu04810  Regulation of actin cytoskeleton
anu04910  Insulin signaling pathway
anu04912  GnRH signaling pathway
anu04914  Progesterone-mediated oocyte maturation
anu04915  Estrogen signaling pathway
anu04916  Melanogenesis
anu04917  Prolactin signaling pathway
anu04919  Thyroid hormone signaling pathway
anu04921  Oxytocin signaling pathway
anu04926  Relaxin signaling pathway
anu04928  Parathyroid hormone synthesis, secretion and action
anu04929  GnRH secretion
anu04930  Type II diabetes mellitus
anu04933  AGE-RAGE signaling pathway in diabetic complications
anu04934  Cushing syndrome
anu04935  Growth hormone synthesis, secretion and action
anu04960  Aldosterone-regulated sodium reabsorption
anu05010  Alzheimer disease
anu05020  Prion disease
anu05022  Pathways of neurodegeneration - multiple diseases
anu05034  Alcoholism
anu05132  Salmonella infection
anu05133  Pertussis
anu05135  Yersinia infection
anu05140  Leishmaniasis
anu05142  Chagas disease
anu05145  Toxoplasmosis
anu05152  Tuberculosis
anu05160  Hepatitis C
anu05161  Hepatitis B
anu05163  Human cytomegalovirus infection
anu05164  Influenza A
anu05165  Human papillomavirus infection
anu05166  Human T-cell leukemia virus 1 infection
anu05167  Kaposi sarcoma-associated herpesvirus infection
anu05170  Human immunodeficiency virus 1 infection
anu05171  Coronavirus disease - COVID-19
anu05200  Pathways in cancer
anu05203  Viral carcinogenesis
anu05205  Proteoglycans in cancer
anu05206  MicroRNAs in cancer
anu05207  Chemical carcinogenesis - receptor activation
anu05208  Chemical carcinogenesis - reactive oxygen species
anu05210  Colorectal cancer
anu05211  Renal cell carcinoma
anu05212  Pancreatic cancer
anu05213  Endometrial cancer
anu05214  Glioma
anu05215  Prostate cancer
anu05216  Thyroid cancer
anu05218  Melanoma
anu05219  Bladder cancer
anu05220  Chronic myeloid leukemia
anu05221  Acute myeloid leukemia
anu05223  Non-small cell lung cancer
anu05224  Breast cancer
anu05225  Hepatocellular carcinoma
anu05226  Gastric cancer
anu05230  Central carbon metabolism in cancer
anu05231  Choline metabolism in cancer
anu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
anu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:anu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    117717711 (Mapk1)
   04012 ErbB signaling pathway
    117717711 (Mapk1)
   04014 Ras signaling pathway
    117717711 (Mapk1)
   04015 Rap1 signaling pathway
    117717711 (Mapk1)
   04350 TGF-beta signaling pathway
    117717711 (Mapk1)
   04370 VEGF signaling pathway
    117717711 (Mapk1)
   04371 Apelin signaling pathway
    117717711 (Mapk1)
   04668 TNF signaling pathway
    117717711 (Mapk1)
   04066 HIF-1 signaling pathway
    117717711 (Mapk1)
   04068 FoxO signaling pathway
    117717711 (Mapk1)
   04072 Phospholipase D signaling pathway
    117717711 (Mapk1)
   04071 Sphingolipid signaling pathway
    117717711 (Mapk1)
   04024 cAMP signaling pathway
    117717711 (Mapk1)
   04022 cGMP-PKG signaling pathway
    117717711 (Mapk1)
   04151 PI3K-Akt signaling pathway
    117717711 (Mapk1)
   04150 mTOR signaling pathway
    117717711 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117717711 (Mapk1)
   04148 Efferocytosis
    117717711 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    117717711 (Mapk1)
   04210 Apoptosis
    117717711 (Mapk1)
   04218 Cellular senescence
    117717711 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    117717711 (Mapk1)
   04520 Adherens junction
    117717711 (Mapk1)
   04540 Gap junction
    117717711 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    117717711 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117717711 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    117717711 (Mapk1)
   04613 Neutrophil extracellular trap formation
    117717711 (Mapk1)
   04620 Toll-like receptor signaling pathway
    117717711 (Mapk1)
   04621 NOD-like receptor signaling pathway
    117717711 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    117717711 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    117717711 (Mapk1)
   04660 T cell receptor signaling pathway
    117717711 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    117717711 (Mapk1)
   04659 Th17 cell differentiation
    117717711 (Mapk1)
   04657 IL-17 signaling pathway
    117717711 (Mapk1)
   04662 B cell receptor signaling pathway
    117717711 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    117717711 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    117717711 (Mapk1)
   04062 Chemokine signaling pathway
    117717711 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    117717711 (Mapk1)
   04929 GnRH secretion
    117717711 (Mapk1)
   04912 GnRH signaling pathway
    117717711 (Mapk1)
   04915 Estrogen signaling pathway
    117717711 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    117717711 (Mapk1)
   04917 Prolactin signaling pathway
    117717711 (Mapk1)
   04921 Oxytocin signaling pathway
    117717711 (Mapk1)
   04926 Relaxin signaling pathway
    117717711 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    117717711 (Mapk1)
   04919 Thyroid hormone signaling pathway
    117717711 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    117717711 (Mapk1)
   04916 Melanogenesis
    117717711 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117717711 (Mapk1)
   04270 Vascular smooth muscle contraction
    117717711 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    117717711 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    117717711 (Mapk1)
   04725 Cholinergic synapse
    117717711 (Mapk1)
   04726 Serotonergic synapse
    117717711 (Mapk1)
   04720 Long-term potentiation
    117717711 (Mapk1)
   04730 Long-term depression
    117717711 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    117717711 (Mapk1)
   04722 Neurotrophin signaling pathway
    117717711 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    117717711 (Mapk1)
   04380 Osteoclast differentiation
    117717711 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    117717711 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117717711 (Mapk1)
   05206 MicroRNAs in cancer
    117717711 (Mapk1)
   05205 Proteoglycans in cancer
    117717711 (Mapk1)
   05207 Chemical carcinogenesis - receptor activation
    117717711 (Mapk1)
   05208 Chemical carcinogenesis - reactive oxygen species
    117717711 (Mapk1)
   05203 Viral carcinogenesis
    117717711 (Mapk1)
   05230 Central carbon metabolism in cancer
    117717711 (Mapk1)
   05231 Choline metabolism in cancer
    117717711 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    117717711 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    117717711 (Mapk1)
   05212 Pancreatic cancer
    117717711 (Mapk1)
   05225 Hepatocellular carcinoma
    117717711 (Mapk1)
   05226 Gastric cancer
    117717711 (Mapk1)
   05214 Glioma
    117717711 (Mapk1)
   05216 Thyroid cancer
    117717711 (Mapk1)
   05221 Acute myeloid leukemia
    117717711 (Mapk1)
   05220 Chronic myeloid leukemia
    117717711 (Mapk1)
   05218 Melanoma
    117717711 (Mapk1)
   05211 Renal cell carcinoma
    117717711 (Mapk1)
   05219 Bladder cancer
    117717711 (Mapk1)
   05215 Prostate cancer
    117717711 (Mapk1)
   05213 Endometrial cancer
    117717711 (Mapk1)
   05224 Breast cancer
    117717711 (Mapk1)
   05223 Non-small cell lung cancer
    117717711 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    117717711 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    117717711 (Mapk1)
   05161 Hepatitis B
    117717711 (Mapk1)
   05160 Hepatitis C
    117717711 (Mapk1)
   05171 Coronavirus disease - COVID-19
    117717711 (Mapk1)
   05164 Influenza A
    117717711 (Mapk1)
   05163 Human cytomegalovirus infection
    117717711 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117717711 (Mapk1)
   05165 Human papillomavirus infection
    117717711 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    117717711 (Mapk1)
   05135 Yersinia infection
    117717711 (Mapk1)
   05133 Pertussis
    117717711 (Mapk1)
   05152 Tuberculosis
    117717711 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    117717711 (Mapk1)
   05140 Leishmaniasis
    117717711 (Mapk1)
   05142 Chagas disease
    117717711 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117717711 (Mapk1)
   05020 Prion disease
    117717711 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    117717711 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    117717711 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117717711 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    117717711 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    117717711 (Mapk1)
   04934 Cushing syndrome
    117717711 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    117717711 (Mapk1)
   01524 Platinum drug resistance
    117717711 (Mapk1)
   01522 Endocrine resistance
    117717711 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:anu01001]
    117717711 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:anu03036]
    117717711 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anu04147]
    117717711 (Mapk1)
Enzymes [BR:anu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     117717711 (Mapk1)
Protein kinases [BR:anu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   117717711 (Mapk1)
Chromosome and associated proteins [BR:anu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     117717711 (Mapk1)
Exosome [BR:anu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117717711 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 117717711
NCBI-ProteinID: XP_034370887
EnsemblRapid: ENSANLG00005019926
LinkDB
Position
12:2729120..2789153
AA seq 356 aa
MAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTY
CQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSND
HICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFL
TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL
GSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEV
EQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtggggccgcgc
tacaccaacctctcgtacatcggagaaggcgcctacggcatggtttgctctgcttatgat
aatctcaacaaagttcgagttgctatcaagaaaatcagtccttttgagcaccagacctac
tgtcaaagaaccctaagagagatcaaaatcttactgcgcttcagacatgagaacatcatc
ggcatcaatgacatcatccgggcaccaaccattgagcagatgaaagatgtatacatagta
caggacctcatggagacagatctttacaagctcttgaagacacaacacctcagcaatgac
catatctgctattttctttatcagatcctgaggggattaaaatatatccattcagctaat
gttctgcaccgtgacctcaagccttccaacctcctgctgaacaccacttgtgatctcaag
atctgtgactttggccttgcccgtgttgcagatccagatcatgaccacacagggttcttg
acagagtatgtagccacgcgttggtacagagctccagaaattatgttgaattccaagggt
tataccaagtccattgatatttggtctgtgggctgcatcctggcagagatgctatccaac
aggcctatcttcccaggaaagcattacctagaccagctgaatcacatcctgggtattctt
ggatctccatcacaggaagatctgaattgtataataaatttaaaagctagaaactatttg
ctttctctcccgcacaaaaataaggtgccatggaacaggttgttcccaaacgctgactcc
aaagctctggatttactggataaaatgttgacatttaaccctcacaagaggattgaagtt
gaacaggctctggcccacccatacctggagcagtattatgacccaagtgatgagcccatt
gctgaagccccattcaagtttgacatggagttggacgacttgcctaaggagaagctcaaa
gaactcatttttgaagagactgctagattccaaccaggatacagatcttaa

DBGET integrated database retrieval system