KEGG   Arvicanthis niloticus (African grass rat): 117722538
Entry
117722538         CDS       T08817                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
anu  Arvicanthis niloticus (African grass rat)
Pathway
anu04014  Ras signaling pathway
anu04015  Rap1 signaling pathway
anu04020  Calcium signaling pathway
anu04022  cGMP-PKG signaling pathway
anu04024  cAMP signaling pathway
anu04070  Phosphatidylinositol signaling system
anu04114  Oocyte meiosis
anu04218  Cellular senescence
anu04261  Adrenergic signaling in cardiomyocytes
anu04270  Vascular smooth muscle contraction
anu04371  Apelin signaling pathway
anu04625  C-type lectin receptor signaling pathway
anu04713  Circadian entrainment
anu04720  Long-term potentiation
anu04722  Neurotrophin signaling pathway
anu04728  Dopaminergic synapse
anu04740  Olfactory transduction
anu04744  Phototransduction
anu04750  Inflammatory mediator regulation of TRP channels
anu04910  Insulin signaling pathway
anu04912  GnRH signaling pathway
anu04915  Estrogen signaling pathway
anu04916  Melanogenesis
anu04921  Oxytocin signaling pathway
anu04922  Glucagon signaling pathway
anu04924  Renin secretion
anu04925  Aldosterone synthesis and secretion
anu04970  Salivary secretion
anu04971  Gastric acid secretion
anu05010  Alzheimer disease
anu05012  Parkinson disease
anu05022  Pathways of neurodegeneration - multiple diseases
anu05031  Amphetamine addiction
anu05034  Alcoholism
anu05133  Pertussis
anu05152  Tuberculosis
anu05163  Human cytomegalovirus infection
anu05167  Kaposi sarcoma-associated herpesvirus infection
anu05170  Human immunodeficiency virus 1 infection
anu05200  Pathways in cancer
anu05214  Glioma
anu05417  Lipid and atherosclerosis
anu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:anu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    117722538
   04015 Rap1 signaling pathway
    117722538
   04371 Apelin signaling pathway
    117722538
   04020 Calcium signaling pathway
    117722538
   04070 Phosphatidylinositol signaling system
    117722538
   04024 cAMP signaling pathway
    117722538
   04022 cGMP-PKG signaling pathway
    117722538
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    117722538
   04218 Cellular senescence
    117722538
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117722538
  09152 Endocrine system
   04910 Insulin signaling pathway
    117722538
   04922 Glucagon signaling pathway
    117722538
   04912 GnRH signaling pathway
    117722538
   04915 Estrogen signaling pathway
    117722538
   04921 Oxytocin signaling pathway
    117722538
   04916 Melanogenesis
    117722538
   04924 Renin secretion
    117722538
   04925 Aldosterone synthesis and secretion
    117722538
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117722538
   04270 Vascular smooth muscle contraction
    117722538
  09154 Digestive system
   04970 Salivary secretion
    117722538
   04971 Gastric acid secretion
    117722538
  09156 Nervous system
   04728 Dopaminergic synapse
    117722538
   04720 Long-term potentiation
    117722538
   04722 Neurotrophin signaling pathway
    117722538
  09157 Sensory system
   04744 Phototransduction
    117722538
   04740 Olfactory transduction
    117722538
   04750 Inflammatory mediator regulation of TRP channels
    117722538
  09159 Environmental adaptation
   04713 Circadian entrainment
    117722538
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117722538
  09162 Cancer: specific types
   05214 Glioma
    117722538
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117722538
   05163 Human cytomegalovirus infection
    117722538
   05167 Kaposi sarcoma-associated herpesvirus infection
    117722538
  09171 Infectious disease: bacterial
   05133 Pertussis
    117722538
   05152 Tuberculosis
    117722538
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117722538
   05012 Parkinson disease
    117722538
   05022 Pathways of neurodegeneration - multiple diseases
    117722538
  09165 Substance dependence
   05031 Amphetamine addiction
    117722538
   05034 Alcoholism
    117722538
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117722538
   05418 Fluid shear stress and atherosclerosis
    117722538
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:anu01009]
    117722538
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:anu04131]
    117722538
   03036 Chromosome and associated proteins [BR:anu03036]
    117722538
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anu04147]
    117722538
Protein phosphatases and associated proteins [BR:anu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     117722538
Membrane trafficking [BR:anu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    117722538
Chromosome and associated proteins [BR:anu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     117722538
Exosome [BR:anu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   117722538
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 SPARC_Ca_bdg EH EFhand_Ca_insen DUF7667 TerB DUF6279 FCaBP_EF-hand EF-hand_11 NBD_C DP-EP Poly_export
Other DBs
NCBI-GeneID: 117722538
NCBI-ProteinID: XP_034377639
LinkDB
Position
17:48140555..48141090
AA seq 149 aa
MADQLTEEQIAEFKEFFPLYDKDGDGTITTKELETVLLLLDQNQTEAELQDMFKEVDADR
NGTIDFLEYLSMMAREMKDTDSQEEIREAFRDFDKDGNVYISAAELSQVLINLVVNLTDE
EVNEMTREADSYWDGQVNYEEFIQMMTTK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatcagctgactgaagaacagattgcagaattcaaggaatttttccccctatat
gataaagatggtgatggcaccatcaccacaaaggaactggagactgtcttgttattactg
gatcagaaccaaacagaagctgaactgcaggatatgttcaaggaagtggatgctgacagg
aatggcaccattgacttcctagagtacttgtctatgatggctagagaaatgaaagacaca
gatagccaagaagaaatccgtgaggcattccgagactttgacaaggatggaaatgtttac
atcagtgcagcagaactgtcccaagtgttgataaacttagtagtgaacctaacagatgaa
gaagttaatgaaatgaccagagaagcagatagttattgggatggacaagtcaactatgaa
gaattcatacagatgatgactacaaaatga

DBGET integrated database retrieval system