Arvicanthis niloticus (African grass rat): 117723196
Help
Entry
117723196 CDS
T08817
Symbol
Got2
Name
(RefSeq) aspartate aminotransferase, mitochondrial
KO
K14455
aspartate aminotransferase, mitochondrial [EC:
2.6.1.1
]
Organism
anu
Arvicanthis niloticus (African grass rat)
Pathway
anu00220
Arginine biosynthesis
anu00250
Alanine, aspartate and glutamate metabolism
anu00270
Cysteine and methionine metabolism
anu00330
Arginine and proline metabolism
anu00350
Tyrosine metabolism
anu00360
Phenylalanine metabolism
anu00400
Phenylalanine, tyrosine and tryptophan biosynthesis
anu01100
Metabolic pathways
anu01200
Carbon metabolism
anu01210
2-Oxocarboxylic acid metabolism
anu01230
Biosynthesis of amino acids
anu04975
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:
anu00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
117723196 (Got2)
00270 Cysteine and methionine metabolism
117723196 (Got2)
00220 Arginine biosynthesis
117723196 (Got2)
00330 Arginine and proline metabolism
117723196 (Got2)
00350 Tyrosine metabolism
117723196 (Got2)
00360 Phenylalanine metabolism
117723196 (Got2)
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
117723196 (Got2)
09150 Organismal Systems
09154 Digestive system
04975 Fat digestion and absorption
117723196 (Got2)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
anu01007
]
117723196 (Got2)
Enzymes [BR:
anu01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
117723196 (Got2)
Amino acid related enzymes [BR:
anu01007
]
Aminotransferase (transaminase)
Class I
117723196 (Got2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Motif
Other DBs
NCBI-GeneID:
117723196
NCBI-ProteinID:
XP_034378552
LinkDB
All DBs
Position
18:complement(23108140..23134734)
Genome browser
AA seq
430 aa
AA seq
DB search
MALLHSSRVLSGMAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEV
LKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFSGAIEDISKMPEQSVLLLHACAHNPTGVDPRPEQWKEMASVVKKKNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE
AKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISMAGVTSGNVGY
LAHAIHQVTK
NT seq
1293 nt
NT seq
+upstream
nt +downstream
nt
atggccctcctgcactccagccgagtcctctccgggatggctgctgcctttcacccaggc
cttgcagctgcagcctctgccagagccagctcctggtggacccatgtcgaaatgggacct
ccagatcccatcctgggagttaccgaagccttcaagagagataccaacagcaagaagatg
aacctgggagttggtgcctaccgggatgataacggaaagccttacgtgctccccagtgtc
cggaaggcagaggcccagattgctgcaaaaaatttggacaaagagtacctgcccattggg
ggactggctgaattttgtaaggcgtctgcagagctggccctgggtgagaacaacgaggtg
ttgaagagcggccggtttgtcactgtgcagaccatttccgggactggagccttaagggtt
ggagccagttttctgcaaagattttttaagttcagccgagatgtctttctgcccaaacca
tcctggggaaatcacacgcccatcttcagggatgccggcatgcagctccaaggttatcga
tactatgaccccaagacttgcggctttgatttctccggagccatagaagacatctcaaaa
atgccagaacagagtgttctcctcctgcatgcctgcgctcacaaccccacgggtgtggac
ccgcgtccagagcagtggaaggaaatggcatccgtggtgaagaaaaagaatctcttcgca
ttctttgacatggcctaccaaggctttgccagcggtgatggtgataaggatgcctgggcc
gtgcggcacttcattgagcagggcatcaatgtctgcctctgccaatcgtatgccaagaac
atgggcctgtacggtgagcgtgtgggagccttcacggtggtctgcaaagatgcagaagaa
gccaaaagggtggagtcacaactgaagatcctgatccgtcccttgtattccaacccacct
ctcaatggggcccggattgccgccaccatcctgacttctccagacttgcggaagcaatgg
ttgcaagaggtgaaaggcatggctgaccgaatcatcagcatgaggacccagctggtctcc
aacctgaagaaagagggctcatcccacaactggcagcacatcaccgaccagatcggcatg
ttctgtttcaccggcctgaagcctgagcaggtggagcggctgaccaaggagttctccgtc
tacatgacaaaggatggccgaatctccatggcaggagtcacctctggcaatgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa
DBGET
integrated database retrieval system