KEGG   Arvicanthis niloticus (African grass rat): 117723196
Entry
117723196         CDS       T08817                                 
Symbol
Got2
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
anu  Arvicanthis niloticus (African grass rat)
Pathway
anu00220  Arginine biosynthesis
anu00250  Alanine, aspartate and glutamate metabolism
anu00270  Cysteine and methionine metabolism
anu00330  Arginine and proline metabolism
anu00350  Tyrosine metabolism
anu00360  Phenylalanine metabolism
anu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
anu01100  Metabolic pathways
anu01200  Carbon metabolism
anu01210  2-Oxocarboxylic acid metabolism
anu01230  Biosynthesis of amino acids
anu04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:anu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    117723196 (Got2)
   00270 Cysteine and methionine metabolism
    117723196 (Got2)
   00220 Arginine biosynthesis
    117723196 (Got2)
   00330 Arginine and proline metabolism
    117723196 (Got2)
   00350 Tyrosine metabolism
    117723196 (Got2)
   00360 Phenylalanine metabolism
    117723196 (Got2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    117723196 (Got2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    117723196 (Got2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:anu01007]
    117723196 (Got2)
Enzymes [BR:anu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     117723196 (Got2)
Amino acid related enzymes [BR:anu01007]
 Aminotransferase (transaminase)
  Class I
   117723196 (Got2)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 117723196
NCBI-ProteinID: XP_034378552
LinkDB
Position
18:complement(23108140..23134734)
AA seq 430 aa
MALLHSSRVLSGMAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEV
LKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFSGAIEDISKMPEQSVLLLHACAHNPTGVDPRPEQWKEMASVVKKKNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE
AKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISMAGVTSGNVGY
LAHAIHQVTK
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccctcctgcactccagccgagtcctctccgggatggctgctgcctttcacccaggc
cttgcagctgcagcctctgccagagccagctcctggtggacccatgtcgaaatgggacct
ccagatcccatcctgggagttaccgaagccttcaagagagataccaacagcaagaagatg
aacctgggagttggtgcctaccgggatgataacggaaagccttacgtgctccccagtgtc
cggaaggcagaggcccagattgctgcaaaaaatttggacaaagagtacctgcccattggg
ggactggctgaattttgtaaggcgtctgcagagctggccctgggtgagaacaacgaggtg
ttgaagagcggccggtttgtcactgtgcagaccatttccgggactggagccttaagggtt
ggagccagttttctgcaaagattttttaagttcagccgagatgtctttctgcccaaacca
tcctggggaaatcacacgcccatcttcagggatgccggcatgcagctccaaggttatcga
tactatgaccccaagacttgcggctttgatttctccggagccatagaagacatctcaaaa
atgccagaacagagtgttctcctcctgcatgcctgcgctcacaaccccacgggtgtggac
ccgcgtccagagcagtggaaggaaatggcatccgtggtgaagaaaaagaatctcttcgca
ttctttgacatggcctaccaaggctttgccagcggtgatggtgataaggatgcctgggcc
gtgcggcacttcattgagcagggcatcaatgtctgcctctgccaatcgtatgccaagaac
atgggcctgtacggtgagcgtgtgggagccttcacggtggtctgcaaagatgcagaagaa
gccaaaagggtggagtcacaactgaagatcctgatccgtcccttgtattccaacccacct
ctcaatggggcccggattgccgccaccatcctgacttctccagacttgcggaagcaatgg
ttgcaagaggtgaaaggcatggctgaccgaatcatcagcatgaggacccagctggtctcc
aacctgaagaaagagggctcatcccacaactggcagcacatcaccgaccagatcggcatg
ttctgtttcaccggcctgaagcctgagcaggtggagcggctgaccaaggagttctccgtc
tacatgacaaaggatggccgaatctccatggcaggagtcacctctggcaatgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa

DBGET integrated database retrieval system