Arvicanthis niloticus (African grass rat): 117723427
Help
Entry
117723427 CDS
T08817
Symbol
Psmd7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
anu
Arvicanthis niloticus (African grass rat)
Pathway
anu03050
Proteasome
anu05010
Alzheimer disease
anu05012
Parkinson disease
anu05014
Amyotrophic lateral sclerosis
anu05016
Huntington disease
anu05017
Spinocerebellar ataxia
anu05020
Prion disease
anu05022
Pathways of neurodegeneration - multiple diseases
anu05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
anu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
117723427 (Psmd7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
117723427 (Psmd7)
09164 Neurodegenerative disease
05010 Alzheimer disease
117723427 (Psmd7)
05012 Parkinson disease
117723427 (Psmd7)
05014 Amyotrophic lateral sclerosis
117723427 (Psmd7)
05016 Huntington disease
117723427 (Psmd7)
05017 Spinocerebellar ataxia
117723427 (Psmd7)
05020 Prion disease
117723427 (Psmd7)
05022 Pathways of neurodegeneration - multiple diseases
117723427 (Psmd7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
anu03051
]
117723427 (Psmd7)
Proteasome [BR:
anu03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
117723427 (Psmd7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
117723427
NCBI-ProteinID:
XP_034378941
LinkDB
All DBs
Position
18:complement(33646721..33654560)
Genome browser
AA seq
320 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDA
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKEKSDVKKEEKKEKK
NT seq
963 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaattggcaaggttggaaaccagaaacgggttgtcggtgtgcttttg
ggatcgtggcaaaagaaagtgcttgatgtatccaacagttttgcagtaccttttgatgaa
gacgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccccaaa
ctgcacaagaatgatatcgccatcaatgaactcatgaagagatactgccccaactcggta
ttggtcattattgatgtgaagccaaaggacctgggacttcccaccgaagcctacatctca
gtggaggaagttcatgacgatgggacgccaacatcaaaaacttttgagcacgtgactagt
gagattggagcagaggaggctgaggaggtcggagtggaacacttactaagagacatcaag
gacactacagtagggactctctcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagctcctggatatcaggagctacctggagaaggtagccagcggcaagctc
cccatcaaccaccagatcatataccagctgcaggacgtcttcaacctgctgccagacgcc
agcctgcaggagttcgtcaaggccttctacctgaagaccaatgaccagatggtggtggtg
tacttggcctcactcatccgctcggtggttgccttgcataacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaggagggacaggaaaaggaggagagcaagaaggagaga
aaagacgacaaagagaaggagaagagcgacgtgaagaaagaagagaaaaaggagaaaaag
tag
DBGET
integrated database retrieval system