Amycolatopsis nalaikhensis: QP939_11705 Help Entry QP939_11705       CDS       T10497                                  Name (GenBank) hypothetical protein   KO K03117   sec-independent protein translocase protein TatB Organism anw  Amycolatopsis nalaikhensis Pathway anw03060   Protein export anw03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:anw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     QP939_11705  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     QP939_11705  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:anw02044]     QP939_11705 Secretion system [BR:anw02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    QP939_11705 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-ProteinID:  WIV59237 UniProt:  A0ABY8XUE2 LinkDB All DBs Position 2380607..2380825 Genome browser AA seq 72 aa AA seqDB search MQQQINDEVGPEFEQLRKPLRELNQLRGIDPRTALTRFVLDPAPAEQTPLTTTPLVAQRP PGSPASVDMEAT NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcagatcaacgacgaggtcgggcccgagttcgagcagttgcgcaaacccctg cgggaactcaaccagcttcgcggaatcgatccacgcaccgcgttgacccgcttcgtcctc gatccagcgcccgctgaacagactcctctcacgacgacgccgttggtagcccagcggcct cccggcagtccggcgagtgtggacatggaagccacctga

DBGET integrated database retrieval system