Amycolatopsis nalaikhensis: QP939_46435 Help Entry QP939_46435       CDS       T10497                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism anw  Amycolatopsis nalaikhensis Pathway anw00362   Benzoate degradation anw00621   Dioxin degradation anw00622   Xylene degradation anw01100   Metabolic pathways anw01120   Microbial metabolism in diverse environments anw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:anw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     QP939_46435    00622 Xylene degradation     QP939_46435    00621 Dioxin degradation     QP939_46435 Enzymes [BR:anw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      QP939_46435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 MIF Motif Other DBs NCBI-ProteinID:  WIV56161 LinkDB All DBs Position 9571213..9571407 Genome browser AA seq 64 aa AA seqDB search MPFIQITIAQGHDDAVKRDLLTAVSAAAAQATGTPESAFRVWLVEVPDTEVMVGGRILRE TRHP NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgccgttcatccagatcaccatcgcgcaagggcacgacgacgccgtcaaacgcgacctg ctgaccgccgtctccgcggcggccgcccaggccaccggaacgccggagagtgccttccgc gtctggctcgtcgaggtgccggacaccgaagtcatggtcgggggcaggatcctgcgcgaa acgcggcacccgtga

DBGET integrated database retrieval system