Aneurinibacillus sp. XH2: ACH33_01980 Help Entry ACH33_01980       CDS       T04247                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism anx  Aneurinibacillus sp. XH2 Pathway anx02020   Two-component system anx02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:anx00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ACH33_01980  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     ACH33_01980  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:anx02035]     ACH33_01980 Bacterial motility proteins [BR:anx02035]  Flagellar system   Flagellar assembly proteins    Others     ACH33_01980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM FtsL Borrelia_P83 Pox_G5 DUF5398 Motif Other DBs NCBI-ProteinID:  AMA71731 UniProt:  A0A0X8D1Y4 LinkDB All DBs Position 403033..403341 Genome browser AA seq 102 aa AA seqDB search MNKKYINVIKKAGVITVRIERTGHIQPIHPYRQQEMRQEEAKKKGKERDQLEISTEALEL QKNQETEAERTERIAELKKQVQAGTYHVDAKLIAEALLKKGM NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaataagaagtatataaatgtaataaagaaagccggggtgataacagtgagaattgaa agaacgggtcatattcagccaatccatccgtaccgccagcaagaaatgcgtcaggaggaa gccaaaaagaaaggaaaagagcgcgatcagttggaaatttccacagaagcgctggagcta cagaaaaatcaggaaacggaggcagaacgcacagagcgtatcgccgaattaaaaaaacag gtacaggctggaacgtaccatgtggacgctaaactgatcgcggaggcgttgttgaagaag gggatgtaa

DBGET integrated database retrieval system