Azoarcus olearius DQS-4: dqs_2584 Help Entry dqs_2584          CDS       T04423                                  Name (GenBank) phenol hydroxylase subunit P4   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism aoa  Azoarcus olearius DQS-4 Pathway aoa00361   Chlorocyclohexane and chlorobenzene degradation aoa00362   Benzoate degradation aoa00623   Toluene degradation aoa01100   Metabolic pathways aoa01120   Microbial metabolism in diverse environments aoa01220   Degradation of aromatic compounds Module aoa_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aoa00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     dqs_2584    00361 Chlorocyclohexane and chlorobenzene degradation     dqs_2584    00623 Toluene degradation     dqs_2584 Enzymes [BR:aoa01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      dqs_2584     1.14.13.244  phenol 2-monooxygenase (NADH)      dqs_2584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  ANQ85614 LinkDB All DBs Position complement(2772758..2773117) Genome browser AA seq 119 aa AA seqDB search MAVAAIGKYEFAPADAIEKFHGAQLLYIGWEDHLLFCAPFAFPFPPTMPFGAIVEQVLPG SFGYHPDFARIDWAKAEWFKSGKPWQPDFSKSLADNGLKHKDVIRFRTPGLTGIAGSCS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccgtcgctgccatcggcaaatacgaattcgcgcccgccgacgcgatcgagaagttc cacggtgcccagctgctctacatcggctgggaagaccacctgctgttctgcgccccgttc gcctttcccttcccgccgaccatgcccttcggcgctatcgtcgagcaggtgctgccgggc tcgttcggctaccaccccgatttcgcccgcatcgactgggcgaaggcggagtggttcaag tccggcaagccctggcaaccggacttcagcaagtcgctggcggacaacgggctgaagcac aaggacgtgatccgcttccgcacgccggggctgaccgggattgcggggtcgtgcagctga

DBGET integrated database retrieval system