Azoarcus olearius DQS-4: dqs_2586 Help Entry dqs_2586          CDS       T04423                                  Name (GenBank) phenol hydrolase subunit P2   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism aoa  Azoarcus olearius DQS-4 Pathway aoa00361   Chlorocyclohexane and chlorobenzene degradation aoa00362   Benzoate degradation aoa00623   Toluene degradation aoa01100   Metabolic pathways aoa01120   Microbial metabolism in diverse environments aoa01220   Degradation of aromatic compounds Module aoa_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aoa00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     dqs_2586    00361 Chlorocyclohexane and chlorobenzene degradation     dqs_2586    00623 Toluene degradation     dqs_2586 Enzymes [BR:aoa01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      dqs_2586     1.14.13.244  phenol 2-monooxygenase (NADH)      dqs_2586 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Ubiquitin_5 Motif Other DBs NCBI-ProteinID:  ANQ85616 UniProt:  A1K8A4 LinkDB All DBs Position complement(2775202..2775471) Genome browser AA seq 89 aa AA seqDB search MSTVFIALQANEDTRPIVEAITADNPQARINEAPAMVKIDAEGRLTVRRASIEERIGRDF DLQELHINLISLSGNIDETDDELTLSWHA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccacggttttcattgccctgcaagccaacgaagacacccgcccgatcgtcgaggcg atcaccgccgacaacccgcaggcacgcatcaacgaagcgccggcgatggtgaagatcgac gccgaaggccggctcaccgtgcgccgcgccagcatcgaggaacgcatcggccgcgacttc gacctgcaggagctgcacatcaacctgatctcgctctccggaaacatcgacgagaccgac gacgaactgacgctgagctggcacgcctga

DBGET integrated database retrieval system