Alkaliphilus oremlandii: Clos_0560
Help
Entry
Clos_0560 CDS
T00607
Name
(GenBank) Transglycosylase-associated protein
Organism
aoe
Alkaliphilus oremlandii
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Transgly_assoc
DUF5518
DUF4064
ABC2_membrane_2
Motif
Other DBs
NCBI-ProteinID:
ABW18122
UniProt:
A8MLV5
LinkDB
All DBs
Position
618303..618548
Genome browser
AA seq
81 aa
AA seq
DB search
MGYIAWIILGALSGWIASIVMGKNSQMGAIANIVVGIVGAFIGGFVFSLIGSVGVTGLNI
WSIIVSVVGSCILLFVVNKIK
NT seq
246 nt
NT seq
+upstream
nt +downstream
nt
atgggttatatagcatggataatcttaggcgcactatccggatggatagcaagtattgta
atgggtaaaaattcacagatgggagctattgcgaatatcgtggtaggtattgtgggagct
tttattggaggattcgtattcagcttaataggctccgttggtgtcacaggactgaatata
tggagcataatagtttccgtagttggatcttgtatattactatttgtagttaataaaatt
aaataa
DBGET
integrated database retrieval system