Asparagus officinalis (garden asparagus): 109823545
Help
Entry
109823545 CDS
T05243
Name
(RefSeq) cytochrome b-c1 complex subunit Rieske-4, mitochondrial-like
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
aof
Asparagus officinalis (garden asparagus)
Pathway
aof00190
Oxidative phosphorylation
aof01100
Metabolic pathways
aof04148
Efferocytosis
Brite
KEGG Orthology (KO) [BR:
aof00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
109823545
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
109823545
Enzymes [BR:
aof01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
109823545
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rieske
UCR_TM
Motif
Other DBs
NCBI-GeneID:
109823545
NCBI-ProteinID:
XP_020245412
LinkDB
All DBs
Position
9:64262124..64269995
Genome browser
AA seq
258 aa
AA seq
DB search
ASSSFFASKNHPVAGDRSPDDSRTSLDSPRRRLIDAGLIGSARGFATDTLAPRQQQDLGL
ADLPATVAAVKNPTSKIVYDEYNHERFPPGDPSKRAFAYFVLTGGRFVYASLLRLLVLKL
VLSMSASKDVLALASLEVDLSNIEPGSTVTVKWRGKPVFIRRRTEDDIKLANSVDVASLR
DPQEDAARVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWFCPCHGSHYDISGRIRKGPAPF
NLEVPTYSFLEENKLLVG
NT seq
777 nt
NT seq
+upstream
nt +downstream
nt
gcctcctcgtctttcttcgcgtccaagaaccacccggtcgctggcgatcgatcgcccgat
gactcaaggacgagcttggattctccgaggaggaggctgatcgatgcggggctaattgga
tccgcaagaggatttgccactgatactctggctccaagacagcaacaggatctaggttta
gctgacctcccagcaactgttgcggctgtgaagaacccaacctccaaaattgtctacgac
gaatacaaccatgagcgctttcctccgggtgaccccagcaagcgtgcattcgcctacttt
gtactaactggtggaaggtttgtctacgcttctctcctccgtctcctagtcctcaagctc
gtcctcagcatgtcggcgagcaaagacgtcctcgcccttgcttcccttgaggtcgatctc
tccaacatcgagccggggtccaccgtcaccgtcaagtggagggggaaaccggtgttcatc
cgtcgcaggactgaggacgacattaagcttgccaacagtgtcgatgttgcgtcccttcgg
gatcctcaggaggacgcagctagggttaagaaccccgagtggcttgtggttgttggtgtt
tgcacgcatctgggttgcattcctctgccgaatgctggggattatgggggttggttctgc
ccatgccatggatcacattatgatatctccggaaggattcgcaagggaccggctccattc
aatctggaggtcccaacgtatagcttcttggaggagaacaagttactcgttggctga
DBGET
integrated database retrieval system