Asparagus officinalis (garden asparagus): 109825157
Help
Entry
109825157 CDS
T05243
Name
(RefSeq) LOW QUALITY PROTEIN: mitochondrial import inner membrane translocase subunit TIM17-2-like
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
aof
Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:
aof00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
aof03029
]
109825157
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
aof02000
]
109825157
Mitochondrial biogenesis [BR:
aof03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
109825157
Transporters [BR:
aof02000
]
Other transporters
Primary active transporters [TC:
3
]
109825157
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
109825157
NCBI-ProteinID:
XP_020247494
LinkDB
All DBs
Position
1:complement(63970868..63975561)
Genome browser
AA seq
194 aa
AA seq
DB search
MGTPETSREPCPDRILDDVGGAFGMGAVGGFASGGGLFSGFDCSMVYLRQKEILWNFHRC
RSATGRTGGFLQMRQGARSAARSAAFGGVLLALIEGAGIMLNRVLSNPQNFPPMEDPGMV
MPPNVPQAEVGGSGIPLSYQNRTQTNPTDKESTGSSSWLGGLFGKKEDVKSSSDGGEKTL
ESFDAPSVPTFEFK
NT seq
585 nt
NT seq
+upstream
nt +downstream
nt
atgggaacacccgagacttcacgcgagccctgccccgaccgaatcctcgacgacgtcggc
ggcgctttcggcatgggcgccgtcggcggcttcgcgtctggcggtggacttttctctggt
ttcgattgctcgatggtttatttgaggcagaaggagatcctgtggaacttccatcgttgc
cggagcgcgaccgggcggaccggcgggttcttgcagatgcgtcagggcgctaggtctgct
gctaggtcagcagcttttggtggggtcctccttgccctaattgagggagctggaattatg
ctcaatagagttttgagtaatccgcagaacttcccgccaatggaggacccaggaatggtg
atgccaccaaatgtacctcaggcagaagttggaggtagtggtattcctttaagttaccaa
aatcggacacaaacaaatccaacagacaaggaatcaactggttcttcttcttggcttgga
gggctttttggaaagaaggaggatgtgaagagtagcagtgatggtggtgaaaagacattg
gagagttttgatgcaccatcagtcccaacctttgagtttaagtaa
DBGET
integrated database retrieval system